! / 1133374785 0 0 0 24784 ` aaaaaaaaaaaHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHddd0000000000000000000000000hhhhhhhhhhhhhhhhhhh''''7 7 7 7 7 7 7 7 7 NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN88p111111111JJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJpppppppppNNNNNNNNNNNNNNNNNNNNNXXXXXXXXXXXXXXXXXXXXXXXXXX *""""EEEEEEEEEEEEXXXXXhhhhhdddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddd p p p p                               9 9 9 9 d d d d d d ۜ D D D D D D D D D D D D D D D D D D D D D D T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T L L L L L h h h h x \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ Ĥ Ĥ Ĥ , , , , , ,              H H H s s s s s s s s s s s s l l l l l l l l l l l l l l l l l l l l l l l l l l l l l l l l l l l l l l l l l l l l l l l l l l l l l l l l l l l l l l l l l l l l l l l l l l l l l l l l l l l l l l l lLLxxxxxxxxx00000000$$$$$$gifEntrycommandExecuteaceCommandCreateaceCommandExecuteaceCommandDestroycommandStackExecuteaceCommandSwitchActiveSetsetLastModifiedgetLastModifiedaceCommandNoWritelastModifiedaceCommandCheckForFilesuAceCommandChoisirMenuuAceCommandGetChoixMenuswapDatamesscrashroutinewriteAccessChangeRegisterwriteAccessChangeUnRegistersessionChangeRegisterswapSuperBlocksessionNewLogFilesessionRequestNewLogFilesessionReopenLogFilesessionRegisterGraphCBsessionRegisterServerCBsessionGetServerCBgetContextsessionInitsessionStartsessionInitializesessionShutDownsessionAdminUserI_own_the_passwdthisSessionsessionTreeCreatesessionTreeDestroysessionDoClosesessionDBTitlesessionDbNamesessionLastSaveTimesessionUserKeysessionUserSession2TimesessionStartTimesessionRegisterisWriteAccesssessionReleaseWriteAccessexternalCommitsessionGainWriteAccesssessionCheckSuperBlocksessionForbidWriteAccessreadlockDeleteFilewriteAccessPossiblesessionSetSaveStatussessionMarksessionClosesessionAutoSavesessionTimeSavesessionDoSavesessionSetUserSessionUsersessionCheckReadlocksessionReadlockAppendFileWinIDsessionSetforceInitexternalServerexternalSaverexternalAliasexternalServerStateexternalServerNamedbPathInitdbPathFilNamedbPathStrictFilNamedbPathMakeFilNameacedbPrintMessagesimpleCrashRoutinebannerMainStringsbannerDataInfoStringsbannerWriteqNamequeryFindCondqueryRegisterWebQueryCDTstatusCONDstatuscondDestroycondConstructqueryKeyParametrizedqueryGrepoldSetForServerqueryParametrizedqueryLocalParametrizedcondCheckSyntaxqueryIsAqueryIsAInitconstraintsInitqueryFindqueryFind2queryFind21queryFind3queryFind31queryCalculqueryCheckConstraintsqueryClearConstraintsqueryConstraintsInitexternalTableMakerSPREAD_MAGICspreadCreateFromFileuSpreadDestroyspreadCreateFromAceInspreadCreateFromStackspreadCreateFromObjuSpreadDestroyColonnesspreadGetTitlespreadGetFlipInfospreadGetWidthsspreadGetMasterKeysetspreadCalculateOverKeySetspreadCheckConditionsspreadFilterKeySetspreadColInitspreadRemoveColonnespreadCalculateOverWholeClassspreadGetPrecomputationpresenceChoiceextendChoicehideChoicespreadDumpDefinitionsspreadDumpColonneDefinitionsspreadColSetPresencespreadColCyclePresencespreadColSetExtendspreadColCycleExtendspreadColSetHiddenspreadColCycleHiddenspreadSaveDefInObjspreadReadDefgetDefinitionFromObjflagSetDictflagflagNameFromDictflagNameaqlCreateaqlExecuteaqlDestroyaqlTableaqlIsErroraqlGetErrorReportaqlQuickaqlGetErrorNumberaqlGetErrorMessageyysyy_yysyyvyy_yyvaqlParseyyparseyyinyyoutyylexyytextyylvalyylengyylookyyerroryyvstopyycrankyysvecyytopyybginyymatchyyextrayylinenoyysptryysbufyypreviousyymorfgyylstateyyestateyyfndyyolspyybackyylspyyinputyyoutputyyunputyypvyypsyystateyytmpyynerrsyyerrflagyycharyyvalyytcharyydebugaqlQueryCreateaqlScopeCreateaqlCheck1aqlTraverseaqlCheck2aqlEvalaqlErroraqlNodeTypeNameaqlOpTypeNameaqlLocSourceTypeNameaqlQueryOutaqlNodeOutaqlNodeOutPrettyaqlNodeValueOutaqlLocOutaqlCheckEnvOutkeySetHeapkeySetNeighbourskeySetAlphaOrderkeySetDumpjavaDumpKeySetkeySetDumpFunckeySetParsekeySetReadkeySetKilltouchedByClientlexavaillexInitlexReHashClasslexClearlexTableReadlexClearClassStatuslexaddkeylexReadlexword2keyiskeyoldlexReadGlobalTableslexmarklexSavelexSetCreationUserSessionlexCreationUserSessionlexCreationStamplexUpdateUserSessionlexUpdateStamplexOverLoadlexDisklexSetDiskiskeynamelexIsGoodNamelexcleanuplexHardDefineKeylexMaxisNakedKeylexAliasLooplexDestroyAliaslexAliasOflexIsKeyVisibleKEY2LEXlexlocklexunlocklexSetIsAlexIsInClassX_CLIENT_PARSINGlexSetStatuslexUnsetStatuslexGetStatusnameWithClassnextNamelexReClasslexClassKeyhashTextNICNIIlex2Checklex2clearlexNakedAlphaOrderlexAliaslexDoAliasNWGNWFNWClexLastKeylexNextlexkillstr2taglexHashMaxvocMaxlexSessionStartlexSessionEndlexAlphaClassListkeySetAlphaHeaplexAlphaMakeAlllexAlphaSaveAlllexAlphaMarklexAlphaClearlexMaxVisiblekeySetCountVisiblekeyNamesAverageINITIALDISKSIZEdataBaseCreatedataBaseAccessInitsaveAlldiskPreparediskWriteSuperBlockdiskblockwritediskFlushLocalCachediskFuseBatsdiskFuseOedipeBatsdiskavaildiskallocdiskfreediskSetSyncWritediskblockreadMAXKNOWNCACHEblockStatusblockCheckblockMaxblockDoInitblockInitblockSaveblockavailblockshowblockunpinnblockreallocateblockpinnblockNextblockGetContinuationblockSetNextblockSetEndblockSetEmptyblockmarkblockrewriteblockwriteblockfriendREADING_MODELSbsTreeArrayFlushcacheMarkisCacheModifiedisCacheLockedcacheUnlockcacheSaveAllcacheStatuscacheKeySetcacheCreatecacheDestroycacheClonecacheUpdatecacheCheckcacheSavecacheKillcacheGetKnownTopcacheGetLockedTopScacheRecidaConnectidaErroridaCreateidaKillidaResurrectidaMergeidaSplitidaAddNameidaFindidaRemoveNameidaGetByNameidaPublicNameidaTypedNamesidaTypedNameidaVersionidaLiveidaUltimateidaChildrenidaExistsidaHistoryidaChangedidaCreateDomainidaSetTemplateidaAddNameTypeidUseridControlidErrorStringidConnectidErroridErrorTextidCreateidKillidResurrectidMergeidSplitidAddNameidRemoveNameidGetByAnyNameidGetByTypedNameidFindidPublicNameidTypedNamesidTypedNameidVersionidLiveidUltimateidChildrenidExistsidHistoryidChangedidCreateDomainidSetTemplateidAddNameTypebs2blockDummyaCacheDummyswapBBlockBinitBgetBdumpBnode2strBstr2nodeBnewnodeBpruneBbranchlenBfreelenBnextkeybsTreeTESTbsTreeGetbsTreeStorebsTreeKillBS_Cache_is_FullBS_Cache_limitBSallocBSfreeBTfreeBSstatusBTallocBTstatusbsTreePrunebsTreeCopybsTreeSizebsTreeDumpkeySetOrderkeySetANDkeySetORkeySetXORkeySetMINUSdumpTimeStampsdumpCommentsbsDumpbsAceDumpniceDumpaStatusswapABlockswapArraysizeOfFormattedArraydumpFormattedArrayuArrayHandleGetuArrayGetarrayStorearrayKillkillFuncstackStorestackHandleGetstackGetarrayStackStorearrayStackHandleGetisTimeStampsXREF_DISABLED_FOR_UPDATEBSTESTBsSubsStatusOBJallocOBJstatusOBJShutDownbsKeybsMakePathsbsCreatebsCreateCopybsUpdatebsClonebsGhostbsPushObjbsDoDestroybsDoKillbsGotobsRemovebsGetKeyTagsbsDoSavebsFindTagbsModelRightbsModelMatchkeyGetKeybsGetKeykeyGetTag2KeybsMarkkeyFindTagbsParentKeybsFindKey2bsGetDatabsGetTextbsGetArraybsFlattenbsKeySetbsTagsInClassbsIsClassInClassbsIsTagInObjbsIsTagInClassbsKeyTagsInClassbsAddTagbsGetTimeStampbsGetNodeTimebsSetTimeStampbsAddKeybsAddDatabsAddCommentbsTypebsAddTruncatedArraybsHandleMarkbsGetMarkAsStringbsPrunebsFuseObjectsbsMakePathShutDownbsGetPathbsSubFuseTypebsFuseModelbsModelRootbsModelCurrentbsObjectCurrentbsModelKeybsCoordShiftbsCoordIndexcheckRegExpSyntaxcheckTextcheckKeycheckDatadnaCopyreverseComplementdnaDecodeStringdnaDecodeArrayrnaDecodeArraydnaEncodeStringdnaEncodeArraydnaRawDumpdnaDumpFastAdnaRawDumpFastAdnaDumpjavaDumpDNAdnaParsednaStoreDestroydnaRawGetdnaExonsSortdnaGetdnaFromObjectdnaHandleGetdnaFileOpendnaDumpFastAKeydnaDumpFastAKeyWithErrorsdnaZoneDumpFastAKeydnaDumpFastAKeySetdnaDumpCDSFastAKeySetbaseQualityDumpbasePositionDumpbaseQualityParsebasePositionParsednaDumpKeyCstylednaDecodeCharrnaDecodeCharcomplementBasednaEncodeCharpepDecodeCharpepEncodeCharpepNamepepShortNamemolecularWeighte_codone_reverseCodone_antiCodonpepWeightpepPIpepDecodeArraypepEncodeArraypeptideDumpjavaDumpPeptidepeptideParsepeptideStorehashArraypeptideGetpeptideTranslatepepGetTranslationTablepepTranslateAndExportpepTranslateAndOutputpepFileOpenpepDumpFastApepDumpFastAKeypepDumpFastAKeySetpepDumpCDSFastAKeySetpeptideDumpKeyCstylepeptideDNATranslatepeptideDNATransmatchTableParsematchTableDumpmatchTableKillmatchTablefixArrayfixDNAdepadpadReadpadContigpadsMapMaxsMapKeyInfosMapParentsMapMapArraysMapMapsMapInverseMapsMapIsReversesMapErrorStringsMapConvertsMapUnsplicedMapsMapKeyssMapDNAsMapFindSpansMapLengthsMapLocalMapsMapCreatesMapCreateExsMapDestroysMapEnclosedBysMapTreeRootsMapTreeCoordssMapDumpclassSortAllsysModelssysClassOptionssysClassDisplayTypessysClassInit_VBat_VKeySet_VCalcul_VClass_VModel_VText_VLongText_VImage_VTable_VTableResult_VJade_VView_VComment_VUserSession_VQuery_VConstraintlexDefineSystemTagsclassHardInittagInit_1_does_not_include_2_1_includes_2_2_point_A1_labelling_A_non_B_Abstract_Address_Aligned_Aligned_into_Allele_Allele_designation_Alu_segment_Amber_Approximate_Match_to_Assembly_repeat_Assembly_tags_Ace_mbly_tags_Author_Autopos_B_non_A_Back_one_Backcross_Balances_Bands_Bitnet_Brief_identification_CDS_CDS_predicted_by_CGC_Calc_Calc_distance_Calc_lower_conf_Calc_upper_conf_Calculation_Calculation_1_Calculation_2_Canon_for_cosmid_Canonical_for_Chromosome_Cleavage_Clone_Subclone_Clone_as_locus_Clone_inside_Clone_outside_Cloning_vector_Coding_Cold_sensitive_Columns_Combined_Comment_Company_Complementation_data_Complex_mixed_Compound_Compression_Contained_in_Contains_Contents_Contig_Contig9_Contiguous_Correct_name_Corresponding_DNA_Corresponding_peptide_Cosmid_grid_Cosmid_vector_Covers_DB_remark_DB_searched_DNA_DNA_homol_Deletion_Description_Designating_laboratory_Detection_method_Df_Dup_Direct_Display_Distance_Does_not_hybridize_to_Dom_let_Dom_one_Dom_selected_Dom_semi_Dominant_Duplication_E_mail_End_not_found_Error_Error_scale_Exact_Match_to_Experiment_Expression_construct_Extent_Fax_Features_FingerPrint_Finished_Flag_Float_Params_Free_dup_Freezer_From_From_Author_From_Laboratory_From_Library_From_left_end_From_map_Full_Full_name_Function_Funny_Match_to_Gel_Number_Gel_length_Gene_Gene_class_Gene_classes_General_General_remark_Genetics_Genomic_Canonical_Genotype_Gridded_Heat_sensitive_Homol_Hybrid_cell_line_Hybridizes_to_In_Situ_In_pool_Inherits_Inside_Int_Params_Internet_Interval_Intragenic_revertant_of_dominant_Inverted_Isolation_Isoschizomers_Journal_Keyword_Laboratory_Layout_Left_Length_Library_Lines_at_Linkage_LiquidN2_Location_Locus_Locus_1_Locus_2_Locus_A_Locus_B_Loop_Mail_Males_Map_Mapper_Mapping_data_Maps_with_Marker_locus_Matching_Genomic_Matching_cDNA_Maternal_Max_Min_Min_score_Minus70_Molecular_information_Multi_point_Multiplet_Muscle_Mutagen_N_gaps_Name_Negative_clone_Negative_locus_Negative_probe_Nick_name_No_overlap_No_stagger_Offset_Old_CGC_distance_Old_CGC_results_Oligo_One_all_One_let_One_recombinant_Origin_Other_name_Outside_Overhang_Overlap_PCR_product_PCR_remark_Page_Paper_Parameters_Paternal_Pattern_Pep_homol_Peptide_Percent_Identity_Phenotype_Phone_Polymorphism_Position_Positive_clone_Positive_locus_Positive_pool_probe_Positive_probe_Possible_exon_Precursor_Primers_Procedure_Processed_mRNA_Product_Properties_Protocol_Pseudogene_Publisher_Qualifier_RFLP_RNA_Rearrangement_Rearrangement_1_Rearrangement_2_Recessive_Recs_all_Reference_Reference_Allele_Reference_strain_Refers_to_Rejected_Rejected_from_Rejected_Reads_Related_Sequence_Remark_Repeats_Representative_Results_Right_Row_Score_Search_Method_Selected_Selected_loci_Selected_trans_Semi_dominant_Seq_length_Sequence_Sequencing_vector_Sex_cis_Sex_full_Sex_one_Shotgun_Significant_bases_Similarity_Site_Source_Source_Exons_Space_at_Species_Staff_Start_not_found_Status_Stop_Strain_Strain_designation_Strictly_Maternal_Structure_Subsequence_TATA_signal_TSL_TSL_site_Tandem_Temperature_Temperature_sensitive_Tested_Text_Params_Title_To_right_end_Trace_quality_Excellent_upto_Good_upto_Fair_upto_Transcript_Translocation_Transposon_Transposon_insertion_Type_Type_1_Type_2_Unit_Length_Unprocessed_mRNA_Variant_Variant_of_Vaxmap_Vector_Version_Volume_Weak_Well_ordered_With_Maternal_Effect_Y_remark_Year_cDNA_mRNA_mat_peptide_misc_feature_misc_signal_modified_base_mutation_old_sequence_pMap_polyA_signal_polyA_site_promoter_rRNA_repeat_region_repeat_unit_sig_peptide_snRNA_tRNA_A_Repeat_Note_Subpool_Colour_ORF_ATG_Splice3_Splice5_Coding_seg_Foreign_Reference_Virtual_row_In_grid_Chrom_Band_Centromere_Dark_NOR_Inherits_from_Fate_Lineage_Parent_Daughter_Group_In_group_Group_member_Neurodata_Send_Send_joint_Receive_Receive_joint_Gap_junction_Contact_Lineage_name_Equivalence_fate_Equivalence_origin_Embryo_division_time_Clone_left_end_Clone_right_end_Derived_from_Derivative_Isolated_for_Wormpep_Replaces_Replaced_by_Confidential_remark_Submitted_Overlap_right_Overlap_left_Repeat_consensus_cDNA_EST_Archived_Lethal_Hand_fixed_Balancer_Region_Hand_verified_YAC_Cytogenetic_Inside_YAC_Inside_Fragment_Bibliography_Links_Link_Chimeric_Non_Chimeric_Size_Interval_Mapping_Main_Marker_Ends_Mapping_p_Telomere_q_Telomere_Drawing_Multi_Position_Does_not_Contain_Contained_Locus_Exterior_Locus_Inside_Rearr_Outside_Rearr_Overlaps_Does_not_Overlap_No_Overlap_Rearr_Overlapping_Rearr_Contained_Rearr_Email_Flipped_Previous_contig_Assembled_from_Assembled_into_Proposed_BaseCall_Genetic_Physical_Restriction_Enzyme_AA_Clone_Grid_Df_Dup_data_Fragment_Pages_Medline_ID_Lab_Location_Match_Method_Motif_MultiMap_Multi_counts_Multi_pt_data_Pool_Unpublished_EC_enzyme_Document_Unit_Enzyme_GDB_id_OMIM_Probe_ATCC_ref_Add_date_Annotation_Approval_date_Approved_Assign_mode_Availability_CS_Cosmid_clones_Created_Current_symbol_Cytogenetic_location_DNA_type_Data_source_EC_ref_Editing_Date_Excision_Data_GDB_GenBank_ref_HGML_ref_KW_Links_to_Max_heterozygosity_Modification_date_Modified_OMIM_document_Old_Num_Originator_Polymorphism_Data_Previous_symbol_Vector_type_Primer_SCF_File_PCR_Cor_Neighbours_Common_bands_Band_Values_Segment_Lengths_Fragment_of_ABI_Wild_type_ABI_Date_ABI_Comment_ABI_Machine_Sample_ABI_Analysis_Run_Start_Run_Stop_Clipped_Old_Clipping_Hand_Clipping_Vector_Clipping_Clipping_Symbol_Anchor_Band_Gel_Band_Lengths_Otto_Main_Locus_STS_SELF_Checked_individually_Outside_YAC_STS_out_AluPCR_by_AluPCR_Hybridisation_by_Finger_Printing_Kpn_THE_Somatic_hybrid_Genethon_Route_2_Inside_YAC_Not_Verified_Locus_Not_Verified_Possibly_Contains_Locus_Possibly_Inside_YAC_Locus_Out_Allelic_Variants_Clinical_Synopses_Cross_References_Diagnosis_Evolution_Historical_Information_Index_Terms_Last_Edited_Locus_Description_MIM_Number_Old_MIM_Number_Population_Genetics_References_Treatment_Main_Text_Animal_Models_map_location_map_error_LongText_PCR_data_Clone_data_Oligo_DNA_Allelep_Allelem_Gametep_Gametem_Tetrad_Centromere_segregation_Genetic_code_Lethal_tested_description_used_in_action_type_internal_ace_query_ace_dump_name_dump_tace_command_external_compound_action_element_params_no_report_status_read_ace_synchro_import_keyset_Homology_Doc_Pairwise_Fuzzy_SMAP_S_ParentclassInit_VPeptide_VSequence_VProtein_VDNA_VPaper_VMethod_VMap_VgMap_VvMap_VMultiMap_VLocus_VGene_VAllele_VInterval_V2_point_data_VMulti_pt_data_VClone_VClone_Grid_VPool_VContig_VpMap_VChrom_Band_VMotif_VBaseCall_VBaseQuality_VBasePosition_VOligoRepeat_VHomology_group_VMap_set_VDoc_VGenetic_code_VPerson_Assembled_as_dummymodelChangeRegisterisModelgetNewModelsreadModelsshowModelJaqlongTextDumpjavaDumpLongTextlongTextParselongGrepparseArrayInitpickVocListclassNamepickListpickClass2WordsuperClasspickIsAclassModel2ClasspickWord2ClasspickIsCompositepickBelongsToCompositepickMakeClasspickGetClassPropertiespickSetClassOptionpickSetClassDisplayTypepickMatchpickMatchCaseSensitivepickRegisterConstraintspickPreInitpickInitpickVisibilitypickCheckConsistencyalignGetalignDumpKeyalignDumpKeySetaceLogExitStringsopenAceLogFilesetTimeStampsAceLogFileappendAceLogFilecloseAceLogFilestartNewAceLogFilereopenAceLogFilesignalCatchInitsignalCatchStatussignalCatchOnsignalCatchOffsignalInitSigActionsignalSetNoCatchprefInitprefReadprefSaveprefReadDBPrefsprefGetprefSetDefFuncprefSetEditFuncprefSetFuncprefValueprefFloatprefIntprefColourprefStringtStatustStatusSelecttStatusSetOptionbIndexTagbIndexFindbIndexGetKeybIndexGetTag2KeybIndexVersionbIndexStatusbIndexTagCountbIndexObjectbIndexNewModelsbIndexInitbIndexSavebIndexShutDownaceErrnoaceErrorMessageaceStatusaceQuitaceInitaceGetWriteAccessaceForbidWriteAccessaceCommitaceSetContextaceCloseContextaceOpenContextaceGetContextacePushContextacePopContextuAceFreeaceHandleCreateuAceArrayCreateaceMakeKeyFromFormataceAllowBlockingaceReadModelsaceAddUpdateaceClassesaceClassSizeaceClassExtentaceNameaceClassNameaceComposeNameaceTagaceKeyaceKeySetaceReadLockKeyaceReadLockKeySetaceReadLockHandleaceReadLockInstanceaceReadLockInstanceSetaceWriteLockKeyaceWriteLockKeySetaceWriteLockHandleaceWriteLockInstanceaceWriteLockInstanceSetaceOpenKeyaceOpenKeySetaceUpdateKeyaceRefreshHandleaceRefreshInstanceaceRefreshInstanceSetaceCommitHandleaceCommitInstanceaceCommitInstanceSetaceDnaGetaceGrepaceGrepFromaceQueryKeyaceQueryaceFilterKeyaceKeyHasTagaceFilterKeySetaceAqlaceMakeInstanceTableaceTableCellaceTableByNameacefprintfacesprintfaceOpenModelaceKeyOfInstanceaceTestInstanceaceMarkaceGotoMarkaceGotoTagaceHasTagaceNextChildaceNextBrotheraceGotoChildaceGetTagaceGetKeyaceGetIntegeraceGetFloataceGetDateTypeaceGetTextaceGetArrayaceRemoveaceAddTagaceAddKeyaceAddIntegeraceAddFloataceAddTextaceAddDateacePrunetableHandleCreateuTableDestroytableCreateFromKeySetkeySetCreateFromTabletableMaxtableCopytableTypestableGetColumnNametableSetColumnNametableSetColumnHiddentableSetColumnVisibletableColumnIsVisibletableSetStringtabValueNulltableCheckEmptytableCleartableSetTypestableSorttableMakeUniquetableIsColumnCompatibletableIsRowEqualtabIsRowEqualtableCopyRowglobalTableCreateHandletabCopyRowtableUniontableDifftableIntersecttableOuttableHeaderOuttableSliceOuttableFooterOuttableOutSetuptableRowOuttablePartOuttableResultDumptableHandleGettableCreateFromAceIntableResultParsetableStoreappCmdlineVersionappTSUserparse_err_typestringsdoParseAceInparseBufferparseBufferInternalparseAceCBufferparseAceInparseAceInProtectedparseControlparseFuncdumpClassPossibledumpFuncdumpKeyBeautifullydumpKeydumpAlldumpAllNonInteractivedumpReadAlldumpDoReadAllbiblioDumpbiblioKeySetbiblioFollowbiblioKeybiblioKeyPossiblebiblioPossiblecopyrightaceGetVersionaceGetReleaseaceGetUpdateaceGetReleaseDiraceGetLinkDateaceGetLinkDateStringaceGetVersionStringcommand.o/ 1133374746 530 202 100644 74132 ` ELF 4( UuUuU u ujU u ujU u ujUuu ujUWVS}uu$ uhWh"W Wt' h*uhu }thh:ju hh:jjj F jSu WVà @/w$Ճ Ve[^_UWVS] jhDShh:jh EPjuǃ jhDSÃhEP jVWSuƃ @/w$Ճ S<$Ee[^_UWVS }] t=thh:wGhh:jSGtG}tAGp Nt5hh:Vuhh:Vw Nuˍe[^_UWVS }u hh:jhx$p(VWC,$h:jjj C hh:jjCC4ChClCp؍e[^_US]Sxu!hh:$${,th h:s,C,{th h:sC{th h:sC{th h:sCCP ;PsyQQK;rA&hh:$Kt+xu"xtxuhh:PKA ;Ar{t sC{ t s C {tt st{t sCt S]UWVS DžDžDžDžUB,hQh:jDžuvu!hUh:$\}uLEPu }u. u uhuuE@=du$ u th`uEq?u u tyhcPu utQhiu tt$hnu thut u ƃs8jPu tAVsMA$uDPh{u uvtVhǻDž|x t<Wtt|A|C|uă|~hWsUB$uDPhu;|lsthuC;||:s u $sVhu ssuF$uDPhuDž‹;w-thu;vӃhdur u t P[rhuCrExtSxt"hh:pUBMAAAp huqhuqu~th h:vFExt@p PMAu~tF@ PhuExQqh h:pUB*qt h puh4uph\upF8u"8u u uMythuApuhu puEhuojjoohuoF8u"8u u uuEhu*o SoDžx8uDžx8ujDžxF8u" 8u u u u 1xtu+$tjj.Rumuu nmDžtDžH8uuF4TK8uE@4&Pu Džt u bttuuJnltu ulUz4th(ullMy4~lhOufl$ Phiu=l u Ioft3f?tKetu`htukhrukuumk=uPhukhuDž]k tYHuD Rt4 P Phu~j u uhujDžp8u2 u uhPuJjDžDž\@$t8tuunDžpP5uDž$PPDžp P PhuÃt=Pjj[Sthu SP5phhurhuF$th uQhuGExthu'huhuh u t@ƿ8u jh4 ughT ug u Ãu(h uh uKgjPSuShugtShuf u Ãu(h uh ufUzthufuhugfhh:jjPǃSPDžhh:jW 8t8%t8t8%uꋕB:%€8t(tB€8t u䋕B:du5Dž8tR8%t8t<8%uꋅ8t,h uXe WGeDžhh:jWBxJ V;~3VP PÃtt; P Phuhu^d WMdhu  u tEMA$t!hh:$H jhDjƃ#hp u uu e u ƿ8 u u t 8thh:Phh:hjhDPƃh"PG u u jhDh'Pƃ uSh ubExt"hh:pUBMAAAuVUB4$ MAp h)u5bu~thubuhuaExt"h h:pUBMAAA h h:jjj uF Puju $taDžDžlDžhDždDž`E@d u j=u tQDžh u u h=h:PÃj-u  u \ƿC8uUBd4'J8Dž` u thMh:PlMythu_uhu_u~thRh:vFUBBB hSh:jjj MA htUt,;t'jhDSdhLPd_h0 u@lqh'hDllыl\19v:޿R8u"jhDlhUdwKtQ;lvI޿Z8u0jhDlh^Phed jhDh'lddtVlCUzduDPhllMyduDPhu lh u u tVuF$t!hh:$jhDjdhT u=h uhP th ud\ hd\UBd `rjd j\Myt"hh:quFUBBB hh:jjj MA \PDž\Dž\DžXhjP hhDS5jhhDSPS Dž8uDžX8u8u _ u u hhDPph uDž\ u \tuut[ZShu߲у)/t߉fD/XPY u uuuZ}Yjjh'Ã\Y $ Pu PuS Y u Ãuh$ uXh$h:jjPDž 5PSSVu Džu  88"Tэ\9v ; t; uK;v ; t; tDž;t;?t;*uC;uꃽtCu: VTtPV=hVTuPVUzt"hCh:rMAUBBBtX thDhHh:jVPhPjMAu hKh:jjj UBPhLh:jVPt"hMh:jMqUBp h u+V VVPhDu Uh[h:PÃMyt"h\h:quFUBBBhDSPMA p hulUu~thjh:vFUBBB u uuu\VT8uMI u  u DžPhDu Th}h: Ph!Pǃ Ph uWƋEptR WÃPVUBthh:Vthh:SMAp huSh u uuTDžDhH uDžDDžPDžLDžDžHDžDDž@u~t vFjuUBDžBPBTB8BxB<u   u u h&PuDž@h-uMA<h3u uFxjeh5u E@xk?h7th9u UBxph>u MAxhh@u uFxaB8u E@xxE8u E@xX]M8u E@xy2S 8u E@xYh_ u t8-u6hp u uuQDžD5Pt [h uDžDYhau| u t8-u6h u uuPDžDhh:Pc8u E@xCre8uiPu txUBT h u uuPDžDhguiPu txMAPhu uuODžDhiuM u *jhPÃC uv^ u j-u D}Mj=u  u u t8uh@u%Mh=h:jdLPhBh:hD uh u u,htu uuMLhSh:H u u hYh:uDP PtLt4PLÃhuKHt?Ph'HÃHhuKt?PÃuS PhuMKhtu uuL!KP5PPExthuJuhuJShku$ETyJUzt"hh:rMA@ǃǃ,thh:uvSp PFhh:Ext"hh:pUBMAAA StjuF SUBMyu0h<u$h:jjj uF hh:jEpUBhPMy t q uF EX PPBMADyTxQTuFHFx HF0BUz tBDMy0BXH,y "A tztqthy8t/h|u uFxPF u UBxPj B PrMAH Puvv ~8t,h|u FxPF uUBxPj B  PjMquFH E@8@<UzTxBH;BT|DžB ǀuwMAxPA uu~ t v F EpHh~uUzt rMAuFD~ EB[FETOF}H Ph|u.FExt@Džx uhuEMyt Ax uhuE u u t8uhuEh_h:<u~thuKEuhu*EjhD<Dž$tW StA8u( St P SUB@ hnh:jPËMA F Bt6tx 0PShS2$PSh|Shu hh:jj DžDž MA‹@ ;hh:R@;hh:uvDž8 h5j0ǃtqx ~Qhh:hh:8W 889G thh:WMQB ; t8hDPhPuv hh:jjj UBtdPÃMyt"hh:quFEXhSUrthh:MAp hu;u~t Fx uhu;Ext"hh:pUBMAAA u t.ƿ 8u u  uvFh h:jPFhPjPSvuh|u:Dž4Dž0Ext @x uNhu~:hu uu;Dž4Myt quFjuUBBPBTBXBxhu 48u MAxa޿8t޿8u uFxp8u E@xjx8u UBxJO"8u MAxk&%8u uFxK(8u E@xH8u UBxCB8u MAxxE8u uFxXYM8u E@xy0S 8u UBxY+8u;Pu MAP.8u;Pu uhuFTW18 u nExxhu@xa޿48h^h:Sƃ jhPÃt UrMYVhuDž468u9 u tEhqh:P0$hth:0 u u 45u~thh:vF0/ hh:jjUBp DžDž MA‹@ ;0hh:R0$tEhh:hh:uv EPB ;er RMAt5hh:uFp PFUBPB@zTxBTMyxCt!h9q8jheuvF@ jPvE@0mUz0m3B@RBtp EpUЉ,MA@ ;}t Ep;,%UzTxBT; MyxCt" 0u UBXMAxC6=$ 0$ P2PhN PhWMqHfDž UBP;u ƅ>ƅ. 1u ƅKƅkBjPMq0 ‰IQRUr jPMq| 0$ P2PhZ PhWMq 9t$ƃ R PhcUrhgMq 0u1 2$Phi/ 1$PhohWEp< 2Ã1MQxYtiYXt&sxtyt6gSPShuO SPSSh 3SPPSSh PSShhWEpn9t"ƃ R PhEp 2Ph PhWMqUB@ ;:MA@ ;~)yTx AT;~uF@Em.ElExxC.h`pUrMAyXt%qX+AP+AXPh8uJ.u+FPPhu%. u jhD PhPt u u苅E PDž(Uzt Bx uhuz-Myt"hN h:quFExt@x tp PMAu~hu-h`uDž(ShuDž(PhuDž(eExt pUBjuMAAPATAxhA\A`ytt qtuFt u ޿8t޿8u E@xpu8u UBxCL8u MAxj#8u uFxJ"8u E@xk%8u UBxK8u MAxa(8u uFxHVB8u E@xx-E8u UBxXM8u MAxyS 8u uFxY8uE@\8uUB`Z+8uUPu txMAP huDž(.8uUPu txuFTh0uDž(68 u tUEtPhuDž(UB@ hXuDž(18uN u ÃjhPƃ MqEp[8-EtPu0huUB@ Dž( u ,()'h|MquFPF@~TxFTE@0MUz0M&B\B` ruDžMA@A@ ;}t Ep9UzTxBT;My4tqљu] jÃh h:Ep0PhSS$UrtBxPh h:r0MqUB@ ;MA@ ;~)yTx AT;~uF@EML%U+BPDtaRPh uMquFEs$Ext @x uhu$Myt"h. h:quFExt@x tp PMAu~uhu^$E@@@xa@h@l@p@T@PDž$޿8t޿8u UBxpX8u MAxC/7 8uuFhA 8uE@l@pL 8uUBlBpU8uMAlApjZ8EPPu  u h^PuuFPhduE@PhuUBPMyPhuuFPh8ETPu  u h^PuE@ThduUBThuMATu~ThuFT18u'h h:ju $$9t0 u h h:ju $$ u IExPZ xTP xPt7‹@P;BTuh@u( MyPt yTtyPu!u~TthtuExt pUBjuMA$t^jh$Ã$uhuh uv^EUByB0DMy0D7 quUB@B@ ;n}t Mq9)h h:EpUzxpzyd Pà Ph h:s S 8uh h:Su PhlMq3EphUr%h h:S  à Ph h:s S 8uh h:S PhMq3EphUrt_h h:SGMyydu'AxPqTqPqlqpqhq EpUB@ ;&MA@ ;~EDA@uFyEFy vF Fp huZExt @x Dhu,Myt Ax uhuu~t vFjuUBu ÃtKjhPƃt MqEpShuuOUzt"h/ h:rMAuFp PFPv EpUB u th> h:PÃMythuuhu Sj u thN h:PÃu~thuuhu Shu jh'hhhƻ tjhDh'PÉ4$tO S Phu SuӃhu$$hu =u&hx h:$hu tch h:u $ƒ8t:\u z;u B:ujhDPÃhP} u tBE@$t!h h:$jhDjÃ)hhu jhDhÃuSUr$ Phuuu MqDž u ƿ18uL u t zh`u uuW8t,h&u uu t" h i hTh h:jEpUBhu?My uhAuE2$`u~th h:vFUBBBBPPuN;rA&h h:$KUBJ z tSBPPuN;rA&h h:$KUBJ )MAuFFFPPN;rA&h h:$KUBJ MAPPuN;r A,h h:$KUJ E5t:5 4t6tE7t_zMquF[EpUB<MquFEpUBh h:Pu uh ulyh4uKMA ;h\u%uNq)ÍS;r4CBPEHA)PA)ЃP!h! h:$KUBPPuN;rA&h" h:$KUBJ z ~PBPPuN;rA&h& h:$KUBJ MAu~FP;PsFF@2h2 h:jEpUBPMAA@uF ~tF@ PEp huUBKMy >h_u&Pu t+Pu t~ huu~thF h:vFExtX DžUB@ +@;}HPMquF DžExt"hQ h:pUBMAAA hR h:jjj uFN ~FhT h:WEphT h:VUr FGhMqu~]hV h:vF9 u uh@u hi h:jEpÃUz|ujj MA|uu! hn h:jjj PEp|thUA ;~TA<t`hq h:A4MBPuv|ht h:E h{u u uhu DžUz|Pr|MB ;B{{{yt"h h:quFUBBBzt"h h:rMAh h:jSuF hu_ huExt"h h:pUBMAAAyt"h h:quF h h:jjj UB u uhu DžMy|Pq|uB ;~xBt_zuVztPzuJh h:R Phu hu DžDžE@$v u tYƿ18u@ u t!h h:P tuuA  u u t$8th h:Pjh'ÃtThP h uUrr(juS S$ hu u ShuDž DžDžDž Myt quFjuUBu MAxa}F%8-Bƿ8u uFx8u E@xa&8u UBxA(8u MAxhv8u uFxjM8u E@xJ$"8u UBxk%8u MAxK8u uFxCB8u E@xxE8u UBxXWM8u MAxy.S 8u uFxY18uX u t$hh h:Ph`uDž )8ui u Ãt6jhPƃ EpUr)huDž &Dž  u  t4uuRMquFjhDh'ƃh h:jjdÃh|VPShS Vuh h:h h:jSPt S VhuDž | u }u!h h:P>}u5h h: h,P t4uuEpUB9u-h6uuvFjEpǃ=y1 hJt P jhZ55UBxPrÃjWhbjEPjSƃW$uuMyxtAxPj VqExt"h h:pUBMAAAjVUB4$ S PhWu SMquFyfDž DžxV4jPu$ jPuƅ>ƅgVjPu$ƒ IQRu jPuƅ.C j9wƅkjPut' Sƒ IQRujPuCvjhpuh@uEUB0B/w$| Mq Phsut t Ee[^_US]S4u!hKh:$dC]ËT$t :tUShhh:jÃu 5URPt- u$PjuSu Pt S]UWVS }u U@9ss9ufhW jhDtÃh|PPhW Suރ SC@9re[^_USM ]@9s&9uthuB@9rڋ]UWVS = jh'hhhƃ tjhDh'PÉ4$teG St7ƿ 8uEPSt E Su Se[^_US]S$Ãt6hKPfthHS҃5?Ћ]UWVSu} h|V" Vt@WPt VÃuGtCShu4$Ãt Vt ;?t;#uĸe[^_UWVS hh:jhƃh|PjSPVh|V SuՅt SjhDhh:jVPǃ uu @PWÃt V jh'hhhà tjhDh'Plj$u hOuu @PWÉ<$u"jjhu uhue[^_UjUEEPEUS]uPh (= uPh  ]AceCommandACEDB_SUBSHELLS \/@% \/@%$ACEDB_NO_BANNERcommand.c \/%User stack underflow startstopshowServer // ACEDB %scommand: %s %s*%s // ACEDB %slist of commands: // Recovered %d objects -drop-regain// Nothing to save -stop-start-gainsavenosave// You have write access // Write access released onoff// Memory statistics off // %s // Time-stamps now OFF ONOFF// Time-stamps currently %s %35s %d -jaq// %s -index//! Unkown class %s //! Protected class %s "%s" // Name %s already exists w= \/;r// Recognised %d objects NOXREFv \;/.Zzcat.gz -c %sgunzip// Parsing file %s %s NOXREF // Parsing file %s%s server can't open stdinserver// Parsing stdin rd-s-T-C// Dump directory : %s IS FIND %s // Found %d objects -active*%s*activetitlejkpperlha-x-xclass-xall-xnocontentnsCcbo // Table saved //# %d lines in this table // Active list is empty -D thistheseIS %s// Autocompleting %s to %s // Sorry, Tag %s unknown >%s-abstracts-a-p-perl-j-J-k-K-h-b-c-f--t KeySet : Answer_%d %s : %s %s?%s?%s? ?%s#?%s? !%s? <%s>%s <%s class="%s">%s <%s class="%s" value="%s" /> %s: %s // %d object listed -a -f %s// Error: cannot write to %s // Unknown tag -t %s // %d: %s // %d object%s dumped -mismatch-unspliced-spliced-cds-x1beginend-x2{ty=>dna,va=>%s,DNA=>} {ty=>pep,va=>%s,PEPTIDE=>// %d object dumped // wspec directory exported wrmlayoutwspec // end of layout file \/%;server cannot open stdin ? -reopen// Error: unknown option. // Sorry, the stack is empty // The stack is now empty // Stored named set %s // Recovered named set %s // empty set %s // usage: clear named set // Cleared named set %s // Sorry, unkown set %s // Executing tace -f %s -A-oselect %s// Error: no query AQL_DEBUG_LEVEL@activeTABLE @active# // %d Active Objects // Usage : // %s DATA_VERSIONmodels // Type ? for a list of options aceCommandDestroy() - received non-magic look pointeraceCommandExecute() - received non-magic look pointer// Please type ? for a list of commands. // Usage: Chrono { start | stop | show} // ACEDB %slist of commands matching %s: // Cannot describe command %s. // Please type ? for a list of commands. // ? command for options of just that command This program maintains an internal list of current objects. You can -Create and modify the list with the simple commands: Find, Follow, Grep, LongGrep, Biblio, Is, Remove, Undo -Visualise in several format the content of the list with: List, Show, Count, Dna, Dump -Perform complex queries and print relational tables with: Query, Table -Modify the data with: New, Edit, EEdit, Parse, PParse, Kill -See the schema and the dataload with Model, Classes, Status, Time_stamps -Manipulate several lists a la polonaise with clear, spush, spop, swap, sand, sor, sxor, sminus Commands are not case sensitive and can be abbreviated. They can be read from a command file with parameters (noted %%1 %%2...) with @file_name parm1 parm2 parm3... if ACEDB_SUBSHELLS is set, lines starting with $ run as an interactive subshell. Everything following // on a line is ignored (comment). To escape any of the special characters use a backslash, eg \@. To see the syntax of all commands type: ? For further help type: help topic // No more previous list available // Active KeySet holds %d object names // Write access couldn't be dropped // Write access dropped permanently // Write access dropped permanently, recent modifs will not be saved // Sorry, you do not have Write Access. // Sorry, you cannot gain Write Access // You cannot get write access to save anyway. // Memory statistics on, some commands will dump statistics periodically // Time-stamps now ON: Each modified data will be time stamped These are the known classes and the number of objects in each class // Usage Model [-jaq] Class : Shows the model of given class, //accepts wildcards // Usage Model [-jaq] Class : Shows the model of given class, // accepts wildcards // %s is a sub class of %s, here is its filter // Sorry, I can t find a model for : %s // Sorry, you must use tace or xace to Read-models // Usage: Read-models [-index] // New models read, save your work before quitting // Usage New Class Format: Construct a new name according to C-language printf(format,n) // Example: New Oligo xxx.\%%d // Only allowed format should contain zero or once %%[number]d KeySet-Read: server cannot open stdin// Sorry, I cannot read from terminal // please specify the keyset on the command line (after = sign). // or give a file name as command line argument // Sorry, I could not open file %s // Accepting data on command line // Type in your data in .ace format, then CTRL-D to finish // Sorry, cannot parse from terminal input. // Use '-ace_in' option to read data on the client side // Error: Could not open directory %s // Usage Find Class [name]: Construct a new current list // formed with all objects belonging to class // Example: New Sequence a\%%.b // may give a7.b // Found %d objects in this class // I search for texts or object names matching %s // Error : missing filename for -o option // Sorry, cannot write output to %s // Error : missing obj-name for -n option // Sorry, I could not find table %s // Error : missing obj-name for -s option // Error : no number after -c option // Error : no number after -b option // Error : no definitions specified after = sign // Error, no table definition specified // Sorry, Bad table definition following = sign // Sorry, could not read table definitions file %s // Sorry, could not read table definitions obj %s // This table has a problem, please debug it in graphic mode version %d = data_version, see wspec/server.wrm // Usage Edit ace_command e.g. // Edit Author Tom, adds author tom to the whole active set // I updated %d objects with command %s // Do you really want to destroy %s %d object%sUsage IS [ < <= > >= ~ ] template : keeps names from current list matching template // Usage Remove [ < <= > >= ~ ] template : remove names matching template // Usage Follow tag-name, change to list of objects pointed by tag // type: model class to see the model of the class // Follow without tag-name, enters active keySets // Error : missing file name for -f option // Error : can't write to file %s <%s class="%s" value="%s">%s // %d object listed, %d not listable // Error: option -f requires filename argument // Error: invalid option %s // valid options are: -a -h -p -j -J -k -K -x -xclass -xall -xnocontent -C -b -c -t -f // Error: integer required after -b // Error: integer required after -c // Error: tag name required after -t // Error: invalid condition %s -x1 should be "begin" OR "end" OR a positive number-x2 should be "begin" OR "end" OR a positive number-x2 should be begin | end | positive number-x1 -x2 are equal, i cannot determine orientation-x1 -x2 must be both specified or absent// Error : cannot write to %s // Sorry, no file wspec/layout.wrm available internal error: code is trying to run the gif command sub-menu, // but the sub-menu callback routine has not been set.// Please provide the full gif command on a single line Could not reopen existing log file.Could not start a new log file.// Pushed the active set on stack // Error: missing integer for spick // Error: spick argument must be >= 0 // Error: spick argument greater than size of stack // The stack now holds %d keyset(s), top of stack holds %d objects // Usage: subset x0 nx, : returns the subset of the alphabetic active keyset from x0>=1 of length nx// usage: kstore name : store active keyset in internal tmp space as name // usage: kget name : copy named set as active keyset // Sorry, I cannot read file "%s" // Error: option -o requires filename argument // Error : cannot open query-file %s // Sorry, option not written yet aceCommandNoWrite() - received non-magic look pointerThe database must have a valid model file in wspec/models.wrm !// File wspec/models.wrm out of sync, consider to 'Read-models'.RvRvvvvvvvvRvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvRvvv}'''''''''''''''''''''''''''''''''''''''''''.c{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{b{{{{{{ia{{`{{{eeeeeeeej{{ {{={{W3i\5Lg&m_T {_""a z({ {{7q {{{{{y_ @IV5{l&O #:-9A/H"{i{;%NF< VM%{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{d1d  {{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{MdbZz{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{ss{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{5a{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{i_{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{lnpyISLSLSLSLSLSLJJSLSLSLSLSLSLSLSLSLSLSLSLKKSLSLSLSLSLSLSLISLSLSLSLSLSLSLSLEJEJSLSLSLSLISLSLSLSLSLSLSLKKef2g2g2g2gVh |{ |{{{{{{{{ |{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{ |{{{ |GCC: (GNU) 3.4.3 (csl-sol210-3_4-branch+sol_rpath).symtab.strtab.shstrtab.rel.text.rel.data.bss.rodata.str1.1.rodata.str1.4.rel.rodata.comment4 83 )L%%  /t42tC2(VH<R x ^4gP@  L  &>#V)n/@|Qc}Dl|u,}~c ~M   $1DP^o`vM*<GRi} #,7AHXf&.7DS\jo| "7ALV`t #2?Ucr'<Pcv,6>HTgs}  / B I X c r             ! 1 B K S i n x        L|D      ' 5 VB command.c_unameunamestatlstatfstatmknodAceCommand_MAGICaceCommandExistsaql_debug_level.0printCmdtaceTestprintUsagegetOnOffshowModelgetDataVersionversion.1doShowModeltime_last_modified.2_nuname_xstat_lxstat_fxstat_xmknodgifEntrycommandExecuteaceCommandCreategetenvaceInSpecialaceInIsInteractiveaceOutPrintarrayCopy_dbguArrayCreate_dbgaceCommandExecuteaceCommandDestroycommandStackExecuteaceInCreateFromTextstackHandleCreate_dbgstackTextOnlyaceOutCreateToStackuAceInDestroyuAceOutDestroyaceCommandSwitchActiveSetuArrayDestroy_dbguArray_dbghalloc_dbguAceCommandChoisirMenuuMessSetErrorOriginuMessCrashuStackDestroyuSpreadDestroycondDestroyuMessFreehandleHandleCreate_dbgaceInOptPromptaceInWordstrcasecmpchronoStartchronoStopchronoReportaceInPosaceInKeymessprintfpickMatchhelpOnkeySetAlphaHeapisWriteAccesssessionReleaseWriteAccesssessionForbidWriteAccessmesserrorsessionGainWriteAccesssessionMarksetLastModifiedwriteAccessPossiblesessionSetSaveStatustStatusSetOptiontStatusSelecttStatustimeNowtimeShowisTimeStampspickClass2WordpickListlexMaxVisiblenameshowModelJaq_VModellexNextpickIsAbsCreatebsGetDatabsDoDestroy_VClassbIndexInitreadModelslexword2keypushTextstackText_dbg__ctypelexMaxlexaddkeyclassNameaceInCheckaceInCreateFromStdinaceInNextstrnew_dbgaceInBackaceInPathaceInCreateFromFilekeySetReadparseAceCBufferaceInStepfilCheckNameaceInCreateFromScriptPipemessdumpmessGetErrorProgramstrstrXREF_DISABLED_FOR_UPDATEdoParseAceInstrcpymemsetfilGetNamedumpTimeStampsdumpCommentsdumpAllNonInteractivefilGetDirnamefilGetFilenamedumpDoReadAllstackClearfreeunprotectcatTextqueryParametrizedaceInWordCutqueryGreplongGrepkeySetORaceOutCopy_VTableiskeyaceInIntaceOutCreateToFilespreadCreateFromStackspreadCreateFromFilespreadCreateFromObjspreadSaveDefInObjspreadFilterKeySetspreadGetPrecomputationkeySetCreateFromTablespreadGetMasterKeysetkeySetOrderarraySorttableHeaderOuttablePartOutspreadCalculateOverKeySettableMaxtableSliceOuttableFooterOutaceInCardstr2tagbIndexTagfreeprotectuArrayReCreate_dbgparseBuffermessQuerykeySetKillkeySetMINUSstrcmp_VKeySetuArrayGetarrayCompressbiblioFollowbiblioDumpaceOutBinaryaceOutBytelexIsKeyVisiblefreejavaprotectcondConstructaceOutCreateToStderrdumpKeyBeautifullydnaGetdnaDecodeArraypeptideGetpepDecodeArraydnaZoneDumpFastAKeypepDumpFastAKeyalignDumpKeySetdepadpaddbPathStrictFilNamegetLastModifiedidControlsessionReopenLogFilesessionNewLogFilekeySetANDkeySetXORmemmovestackExtend_dbgdictHandleCreatedictFinddictAddtableCreateFromKeySetatoiaqlCreateaqlExecuteuTableDestroyaqlIsErrortableOutaqlGetErrorReportaqlDestroykeySetCountVisibleaceCommandNoWrite_VSequencesMapLengthsMapCreatesMapDumpsysModelsstackCursorstackNextTextlastModifiedtimeShow2 5Me" # $ $% # &! +'= H(^)r* , -./ , $)#30;1o w3 ' 4 4 5+6: E(U ^- 7 8 3 3 '3D L3 7 8 39:#;71T< = 7 8>&%9 A&_j%y &? @A @B @C) 1&DDrE   & FG3 A G O&| &% &   &  &;  C &V ?l H|  &  3  &  &   3@ If  n &  3 J K L J  M  &  &  >  ` ?~  & N  & J  & O P N   &*  N  p ? Q  & R    *  N  p ? ? N   O P K  &. \ S?TU, 4&Y a&qVyW &X &X &! 'X/ 5 =&M U&YZ[[Y &? &A `?u }&\G]^ _>\FGs`Y\ &ab &c"d'_M U&n v&J &N &K? e &+f0P8 @&S?d l&t |&g &Z &? & &7 ?&LNX `&r {-h ijjd l&9 ikFl#\5m> F&KP^ f&z9 n% 7 8 o &0?7 [pfD q  q , $rs  t &: B3kuy0 & &N & 3$ /(FDNvSPpwpD qw/?G  s q &N &4 <3c n( , $ &  x, D O Tyt   F y  t   z  % -&C K&^%{ 7 8 o & &{ | &  z(}3}R~X}`P{ 3 ( " *  /  ; xP  U  [ k  <     !'!r2!s@! E! K!xd! l!&!?! !&")"?[" f"t""""%""?" "&" #-#d%#g/#h:#pO#D#$+$h8$ >$X$j$$ $3$ $ $i$ $F%% #%(F% N%iW%gh% u%4% %&%9% %% %q& &3;& B&S& [&&~& &3&?& 'p'r4' <'W' f' k'Ft'q' '&'''' '3' '3( (& ( ((&\( d(&(1()p+)p6)?O) U)@s) ~)@) )@) )@) )@* *@(* 3*@N* Y*@w* * * * + ++@A+?[+ c+&++g++ +&+ +@,?+, 3,&c, t,q, , ,- -&=- H-@a-- -&- -@-s- -.1*.p:.w_.wu.p.D. .&. .-.h. . .q /s!/ )/&O/ `/qt/p/D/ / /q// /&0 0*0 20&R0i0\r0 z0&0 0&00l0 0&0N 1 1&*121 :1&B1:G1Pl1 t131 1311I2 2302 823^2u222 2&2 2(2 2'22 3:3 3&34'484 @4&Y44445:'5 /5&F515 5&5 5&5 5& 6p6D/6 76&I6 Z6qt6 |6&6N6 6&6 6,66?6 7?#7570N7 \7-7Z77m77 77\7 88 8&8.8 48^8 m88 8i8 8i88P8 8389 9 9&!9OC9 K9&d9 l9&y9N9 9&9%9 9 9 9 9 999P: :9: A:&_: g:3:D: : :F:q: :: :&; ;&=; E;3m;?; ; ;F;q; ;3; ;;< "<32< :<&\< d<&< <3<?<\<G=\=(=\7= ?=&U=_h= p=&~= =&= =&= =&= = > >4$>4> E>4W> `>y> >4> >4> >3? ?\? "?F1?C? N?(o?? ?3???? ?3? @&(@ 0@&N@ V@3~@?@ @r@@ @'@@@A A&AA IA&YA aA&A1AA?A &B ?B gB B B B C 4C ]C C C C D %DYD }DD DsD E )Eq5E ;ERE1iE qE&E E?E EqE EqFpF?GF OF3sF F(F F4F\FGF G4!G 2G4fGIG G3GIG G&G GHvHHHI)I\1IEImNI SIFbI mI&III\"J9JQJ\YJmJmvJ {JFJ J&JmJ J&J J&JK\K!K &KFAK\IKRK WKFnK yK&KmK\K KFK KF L LF#L (LF?L JL&kLmtL L&L\L LFL L&7M ?M&MM1uM }M&M M&MDM M MFM,M?NEN MN&kN sN3NIN N&N N&N N&O "O&HO1bOO;O?O O P `1R` Z`&|` `3`I``1`?` aqa &a&3aN?a Ga&Xa]aPua?a aqa a&aNa a&aaPa b&b b !b &b +b@b Eb KbtUb<gbDpb xb&bb b&b0b b&b b b7b b8b cnc !cD)cqQc Wc,ac gc$wc%c c7c c8c coc c&c c c,c d0dd %d&Adcd?{d d?d d&d e e&0e@e EeM[ene seMe e'e e&e e&ee f3Kf Pf7Wf \f8f f7f f8g g7g g8cg hg7og tg8gggh?h Jh3dhsh {h&h h&h h&i*i /i76i ;i8mi ri7yi ~i8i i7i i8j ,jjj rj&j j&jjj j&k #k3kIk k3k k(l l4+l 7l4Wlbll l3l?l l&l l'lm $m(Hmm m3mm m4n n&n?3n ;n&rnn n3%o -o3Do Lo'`o ho&~o o&o o3o o3o p(p?2p :p&qpp p3q q&#q +q&dq?xq qsq qqqprD!r -rqCr Nrt_r er$sr {r&r!rPr0r r&rrr r&1s1Ks\sps s s t 2t [t t t t t (u Qu zu u usu uqu u&v 5vsHv Nviv1|v v&v?v1 w w wt1w :w-Dw Jw$Ywaw gwsww w wiwqw9w0w w&xDx *xqHx \x axFjxqx1x x&x1xyy y##y(y3yAy GyMycypy yyyyy y3y zz"z *z&6zDz1}zzkzzz\z { {kL{[{Zg{Y{{{ {{ {&{{{ |& |<:|0l| q|7x| }|8|| |=|?||g|}} }<S} Y}&c} l},v} |}$} }&}}0} }&~*~ /~ 4~ 9~ >~N~ S~ Y~tc~<l~~?~ ~~~~0~~p~? @. 4@] c$q? &?  -" (h3BJ P\p9}  i,\ˀ9       t<- 2MH\]0s{ &ԁV݁V   $(,048<@DHLPTX\`dhlptx|  $(,048<@DHLPTX\`dhlptx|  $(,048<@DHLPTX\`dhlptx|  $(,048<@DHLPTX\`dhlptx|  $(,048<@DHLPTX\`dhlptx|         $ ( , 0 4 8 < @ D H L P T X \ ` d h l p t x |                                          $ ( , 0 4 8 < @ D H L P T X \ ` d h l p t x |                                          $ ( , 0 4 8 < @ D H L P T X \ ` d h l p t x |                                          $ ( , 0 4 8 < @ D H L P T X \ ` d h l p t x |                                          $ ( , 0 4 8 < @ D H L P T X \ ` d h l p t x |                                   $(,048<@DHLPTX\`dhlptx|  $(,048<@DHLPTX\`dhlptx|  $(,048<@DHLPTX\`dhlptx|  $(,048<@DHLPTX\`dhlptx|  $(,048commandmenu.o/ 1133374746 530 202 100644 16424 ` ELF54( UuUuU u ujU u ujU u ujUuu ujUWVS$DžE UEjj jjulj$ SPWuDžƃxt!9Fu$~tt)u%hhiuh "~uDžqDž W<$<$hhijhSPDžDžDžƅDž WÃu DžPRtrFt,u#uWSvPMFWSv Pn~t2Fu+u"PPP66~t0Fu)u PRP\uDžƅt+hwPyuOt Ut Uh-hij$U t  We[^_øUWVShThijjj2ƃ ÿxt:Et*E Ct"h^hiWGV‹CC B${uhehijVGBye[^_US u uu: ut#8-th{hijPU؋]UU uEЃ):-thhijRUX?hS/H.<X/-,-c,zntHgGl<Fs$Firx, x T FIbl d v L aKP12384p567X89DpPppPp_XweEkmM B8DdRYFZ@JIHhVFIFN@CLul-*#,jLQl0X`YZ[l\]8^_, ` Quit : Exits the program. Any command abbreviates, $starts a subshell, until empty linesystem_list : issue the binary AceC system list dumpSave [-drop | -regain] : Save current state otherwise the system saves every 600 seconds -drop (default) drop write access after saving -regain regain write access after saving NoSave [-stop | -start] : Stop or start all database saving, the -stop option prevents any saving by any command, you must use the -start option to turn saving on again. This is particularly useful if you want to test scripts that use tace for large scale database updates without altering the database. -stop (default) turn saving off -start turn saving on. Writeaccess [-gain | -drop [save | nosave]] : Set write access status -gain (default) get write access -drop lose write access, with or without saving. Read-only : Definitively drop present and future write accesslastmodified : Returns time database was last modified as a string in acedb time format.ID : id interface - type ID ? for commandsClasses : Give a list of all the visible class names and how many objects they contain.Model [-jaq] model : Shows the model of a class or subtype, useful before Follow or Query commandsFind class [name] : Creates a new list with all objects from class, optionally matching nameFollow Tag : i.e. Tag Author gives the authors of the papers of the current listGrep [-active] template : searches for *template* everywhere in the database except LongTextsLongGrep template : searches for *template* also in LongTextsList [-h | -a | -p | -j | -x etc.] [-c max] [-f out_filename] [[-t] template] lists names [matching template] of objects in active list in [human | ace | perl | java | xml] style other styles: -J -k -K -xclass -xall -xnocontentShow [-h | -a | -p | -j | -x etc.] [-T] [-b begin] [-c max] [-f out_filename] [-C] [[-t] tag] outputs full object data for active list in [human | ace | perl | java] style -T show time stamps, -b begin at object b, -c show max obj, -C ignore comments the last parameter restricts to the [tag]-branch other styles: -P -J -k -K -xclass -xall -xnocontentIs template : keeps in list only those objects whose name match the templateRemove template : removes from list those objects whose name match the templateQuery query_string : performs a complex query - 'help query_syntax' for further infoWhere query_string : same as Query, kept for backwards compatibility, do NOT useTable-Maker [-active] [ -h | -a | -p | -j | -x etc.] [-b start] [-c max] [-title] [-o out_filename] [-s obj_name] {command_infile | -n name | =} [params] commands come from file, named Table class object in database (-n option), or command line (= option) -active searches active list, -s stores in database in Table class output styles are as in List, Show (see them for additional style options)Biblio [-abstracts] : shows the associated bibliography [including the abstracts]Dna [-mismatch] [-unspliced | -spliced | -cds] [-C] [-x1 begin] [-x2 end] [[-f] out_filename] : Fasta dump of related dna sequences -mismatch allow mismatches in construction of dna -unspliced | -spliced | -cds for intron/exon objects, dna can be dumped for exons + introns, the spliced exons or just the CDS within the spliced exons. x1 and x2 may be absent OR "begin" OR "end" OR a positive number, [-f] out_filename output file for dna. Peptide [out_filename] : Fasta dump of related peptide sequencesAlignment [out_filename] : Fasta dump of related sequencesArray class :name format : formatted acedump of A class objectKeySet-Read [in_filename | = Locus a;b;Sequence c] : read keyset from file filename or from stdin or from command linespush : push active keyset onto stackspop : remove top keyset from stack and make it the active keysetswap : swap keyset on top of stack and active keysetsand : replace top of stack by intersection of top of stack and active keysetsor : replace top of stack by union of top of stack and active keysetsxor : replace top of stack by exclusive or of top of stack and active keysetsminus : removes members of the active keyset from the top of the stack spick nn : pick keyset nn>=0 from stack and make it the active keysetsubset : returns the subset of the alphabetic active keyset from x0>=1 of length nx kstore name : store active keyset in internal tmp space as namekget name : copy named set as active keyset kclear name : clear named set Parse [-NOXREF] [-v] [in_filename] : parse an ace or ace.Z or ace.gz file or stdin, until ctrl-D or EOF [-v] print detailed statistics about parsingPParse [-NOXREF] [-v] [in_filename] : as above, but don't stop on first errorParse [-NOXREF] [-v] [in_filename] : parse a file defined on the server, run aceclient -ace_in to parse a file or stdin defined on the client sideserverparse : parse files in server modeWrite out_filename : acedump current list to fileEdit ace_file_command : Apply the command to every member of the activelistEEdit ace_file_command : Apply the command to every member of the activelist, but unlike "Edit", conintue processing objects even if there is an error.Kill : Kill and remove from acedb all objects in the current listMore : If there are more objects to listMore : If there are more objects to showMore : If there are more lines in the tableMore : If there are more dna or peptide to dumpRead-models [-index]: reads models, [reindex whole database] you must own the database to do thistace [-f in_filename] [parameters] : Execute a file of acedb commandsStatus {on | off} : Show current stats or toggle statistics display {-code -database -disk -lexiques -hash -index -cache -cache1 -cache2 -array -memory -all} : select stats to print Date : prints the date and timeTime_Stamps {on | off} : Show current setting or toggle time stamps creationChrono {start | stop | show} built in profiler of chrono aware routinesTest : test subroutine, may varyAQL [-h | -a | -p | -j | -x etc.] [-s] [ -f in_query_file] [-o out_results_file] new ace query language, -s for silent output styles are as in List, Show (see them for additional style options) plus -ASelect ... : new ace query language, use AQL to get optionsNew Class Format : i.e New Plate ya\%dx.y creates ya8x.y if ya7x.y existsCount : number of objects in active keysetUndo : returns the current list to its previous stateDepad [seqname] : depads an assembly, or currently padded assemblyPad seqname : pads an assemblyGIF : access to gif drawing submenulayout : export the layout fileDump [-s] [-T] [-C] [directory]: dump database, -s splits by class, -T gives timestamps, -C ignore commentsdumpread filename : read in a dump, filename must be first dumpfile of a set of dump files.newlog [-f old_log_name | -reopen] : Starts a new log file renaming the old log as "log..wrm" -f allows you to specify a name for the old log file. -reopen simply closes the log and then reopens it, this is useful with system rotatelogs script supplied with some unix systems that can be used to control general log filesshutdown [now] [norestart] : Closes the server (you need special privilege)who : who is connected now (you need special privilege)data_version : data served now, as stated in wspec/server.wrmwspec : export wspec directory as a tar filepasswd : change your password.user passwd|group|new|delete userid [password group] : Create/update/delete userids (you need special privilege).global read|write none|passwd|world : Change global read/write permissions for database (you need special privilege).domain group|new|delete domain-name [group] : Create/update/delete domain names (you need special privilege).Parseremote [-NOXREF] [-v] in_filename : parse a file defined on the servers filesystem.PParseremote [-NOXREF] [-v] in_filename : as above, but don't stop on first errorDumpremote [-s] [-T] [-C] directory : dump database to a file defined on the servers filesystem, -s splits by class, -T gives timestamps, -C ignore commentsdumpreadremote filename : read in a dump held on the servers filesystem, filename must be first dumpfile of a set of dump files.Serverlog [-f old_log_name | -reopen] : Starts new log and serverlog files renaming the old logs as "(server)log..wrm" -f allows you to specify a name for the old log file. -reopen simply closes the log and then reopens it, this is useful with system rotatelogs script supplied with some unix systems that can be used to control general log filesCould not find "%s" in the command.c array of commands.? : List of commandsHelp : for further help// : comment, do nothing-f-oClear : Clear current keysetcommandmenu.c acedbGCC: (GNU) 3.4.3 (csl-sol210-3_4-branch+sol_rpath).symtab.strtab.shstrtab.rel.text.rel.data.bss.rodata.str1.4.rodata.str1.1.comment4O ;p ) % 0= /$42$X"C2|4R44/5[l7  :&!>'V-n3 =_IMW_fnv~x #9BIQYdrcommandmenu.c_unameunamestatlstatfstatmknodchoixMenugetFlagFilegetNoFlagFile_nuname_xstat_lxstat_fxstat_xmknodaceCommandCheckForFilesuAceCommandChoisirMenuaceInCreateFromTextaceInCardaceInKeyuAceCommandGetChoixMenuuMessSetErrorOriginuMessCrashaceInCardBackaceInWordstackHandleCreate_dbgpushTextstrcpycatTextpopTextstrnew_dbguStackDestroyuAceInDestroyuArrayCreate_dbguArray_dbgstrcmp 5Me E JU Z  !""A L#a# $%&' !(+Q Y)| ) * %4 <%  0 T x     , P t     ( L p       $ H T \ l      D h      @ d      < `      8 \       4 X |       0  T  x       ,  P  t       (  L  p      $  H  session.o/ 1133374747 530 202 100644 51036 ` ELFs4( UuUuU u ujU u ujU u ujUuu ujËT$HtHHáLT$LS\$ % ‰%  ʉK% ‰%  ʉSK% ‰%  ʉSK % ‰%  ʉS K% ‰%  ʉSK% ‰%  ʉSK% ‰%  ʉSK % ‰%  ʉS % ‰%  ʉ[UShhjuÃ=<t j< S$=tЃ j1=DtDjp$P t S]UWS]=t 5 Qǃuh jHjhSP=<t j< W$L<$h W tI=0t! 5050 jÉ$$=tЃ j=DtDWp,P( We[_Ujjuj(8UjjjjUVSE U=4}t h0Ãy$Et4=0t% RuVQ50E tREPh$ÃtE0t 4؍e[^US]=4=0u$jh0h$4=8t7=0t.8jjjju ht=0tS50]U=0t(u5004UEt 8txu#hh$<UEt/8t*xt$xtxtx tx(t x0tx8u#hh$$DáDUhhjjáUS4 P;tI h(u5 jPh$Ph9t h uu h jh8jjh; t P ht jh8jjhA t P h jhJhLhPh; t P h jhJhLhAh; t P h jh8hWhWhXà t P$=Dt Dp h0E 55PE55P4$jE 5$5 P =DtKU؃DppRUЃDppR =Dt Dp Phhhh hhhV = t7 jÃu!hh$ S$$($;thhP]UuUWVShdhjƉ$hJhLh^h;à XPSuqt;=t6 XPulSuhQSuh6 Vh8hWhWh;PuhLt Ve[^_UWVS }99_ u fjjÃu&hh$u hhjPEPS*hh$L"U9}9G tA9|}t ue[^_UVSEjhLhthAjhWhJPƃ t Stq Vt: VEPVt V4$t( V u5(he[^US5=,u!h h$=u:jj5,t!hh$  5,$hyhLhthAà thWPuPh<t S, 5${]UWVS jhLhthAÃ=,t!h+h$x=tRjS,t: 5,,t Sq 5 hhS,uB PSh5t S=jj5,ti= uPh 5,,5t Sr j P5hƉу QV5,5$t Se[^_UPtUVSuEEEEVÃu VPhEPjj:SEPjj!StmEPjj!StXhjj=StBh jj!St,hjj>Sthjj!Su h$iEPjjbS$5l5puxuhuh jhe[^UVSpt PÃu ^EPj5StEPj6Su" h$jGSu" h $EPjFSt$EphjjES$p Shjuà hjuƃPSthhSthhV uue[^UVS,EEuÃu ƃ>6EPj5SEPj6SjESEPj5VEPj6VEPEPuuuu uj5VEPjj!Vuj6VEPjj!V hjjES EPjFStujFV S4$ V$e[^UWVS(Eh$8hjjhqhjPU"޿Y 8u E  uP ue[^_UWVSDž}jhyjuDžx ~nuSfD/P4S$u Dž9P t Ve[^_UVS jhJhLhehA ` Pjh=t:hh(u h`  =t!=t||9tW hkt!=t .|"5Ph @Ph P5h h =@u$ h u h,  j PhX jjPjj u h t S ht j u h bu h jhjhhAà t P$ jhjhhAà t Pj$ jhjhhAà t P2$u hL(Empty_db  lpS=t| Phu h| h$jhLhehAÃhyjPƃuSh,Vj/jh`4$t S jhyhLhthAÃhyjPPjjhVt S je[^ááu|~ =ø=uUVSpSƃu+hh$PhEPjj2Vu+hh$PhhhjuÉ4$؍e[^US@5hÃu!hh$=ujGShjj3Sj2SuZj2Sj!Su#$Pjj2SEEPjj2S=hthhjj8Shjj4S=lt5lj?S=pt5pjFS hjj=Sh jj!S hjj>Shjj!SjEtEPjjbSEPEPEPEPEPEPhE؍EPjj7S EPjj!S$E؍EPjj;ShE؍EPjj9ShE؍EPjj!ShE؍EPjj!ShE؍EPjj!ShE؍EPjj:Sh E؍EPjj!Sh E؍EPjj!ShE؍EPjj!S5EP 5hP 5EP 5hP uj5SEPjj!Suj6SEPjj!SS]USE 5tà 5hj4Phjj3Sj]Su<=Pu!h8 h$0hPjj]Sj^SuEPjj^S5EP5tPhPt%jEPh uuS5EP5tPhPt%jEPh uuS S]UVS]=TuhZ hjT9uxEPS5TtEYE Sƃt(EPjhPV4$uS5TEe[^US Pu hl P jNjPh jhhh5hP$ÃtjFPu0hh$h`hhhj SP]USI&=tu jÃ=t4 S$Ã5SuEP5pS u S h=u | $xhlp h5h =LtL=tډЋ]Ã=(US=(= u1 j&t Åt jt=,tk h= t h2 j-u hF ju hdtGu ht(=HtH]Ut(=HtHUWVS XEt, X jE=,tSjhLh^h;ÃEuPhSht SjhLh^h;jhWhJPà u+Vh|t VVt Vh hjj E: Sj#Su StPu SujuUB ;BsZ uPuu1}t u SXwuF ;Fr}tAE8u huhH}t u Se[^_UWVS }jjhhAÃ5$hSƃt P S5t Su>t3jjjhAÃPht S W e[^_UWVS5$hJhLhAh;ƃ u!h! h$jhWhJVÃt VE Sƃq8Vj:S$ƃt6 Sƃt$ Sƃt Sƃu8 S HPjhLhAh;Ph<jjVhAƃjPEhJjVuEfE*hyjVuEEt0}tVuhtVuhtt V Se S5Ee[^_USjS=t S 9t!5hЋ]U =HtHU= uZ=\t=\B j t" jt\\ËD$ US] `=dud~`}u-hh5d5`tgh;`~Z h$ P5h$S$$Phd]Uu$U= t;jj}utjjUWVS }] Eƃt! t'll=ltEPV5lEPV5PtnE 9vd h uWhl$$ EPV5PBt9uWh4#h\ hShlEe[^_UWVSjjÿ$jShjSÃjjtC9v)ރ w h9j4$t?Vh,t(VhtVhe[^_UWVS]u hnup=pw4p$J@p,h h5php=pwYp$t hjj$-ph h5php[uwpCx(t 'pth h5phpuZpx xh h5phpuwptt /*pKp7h h5php=pp$0pt hDjjppt hxjj$Jh# h5php=pwsp$Hpxtpxt j(h9 h5phpc;<95xu9tt p=pt#p5xt jpЍe[^_Uhut j}tUVS]=t!hr h$0;t!u <_tB<u߅th~ hjSe[^UVS=P=t5PP=u j$5ht5VPhLPuE5ht5CSVPhRPt5Pte[^áPU=t hPh3t9UVSh hjÃ=|t=| PhjhhA t$|t SSjhhAƃhPu!|t SghVu!|t S0|Vht Se[^UWVSh#hjƃ= jdxSPS5VhjhhAPh[hhhhÃu>Phhh t VP$Pj P$PhtIQtS$hhu+Phhh ?=,t! j P5ht VЍe[^_US hhÃtuhgP$]UVSt`hjP h|hjƃ= =jd]SPS5Vh8jhhAPh[SShu9=,tPShht VRPh=,t5HPht Ve[^U= =tu hu5=,t PhhX+=,t5hUWVSDždhhjXfu$Xt X Xh8jhhA tjhJjPddu#PhUdx > hhjjdp hDž\ dƒx Ћ\P4VXh8jhhAPhxShS @`j.Vƅ"Fэ\19v;.t K9v;.u9C`9>;tPh~QxPhVpPh~SiDžljjlPjjjhWS 2l;h!hhp Pt}DžTDžPDžLXhWhJSÃ0 SDƿ 8u: SDt$h4hXPTD8u7 SDt!h7hXPPRD 8u5 SDth:hXPL SxPpLTPtHPh H Pu2=,t) 5xPpth4 \d\9J Ddt dXt XhЍe[^_ËD$@+$esession.cMemory allocation failurelogACEDB_NO_BANNERrdwspecdatabaserwrmmodelswhelppasswdDon't-know-wholockwWrite access dropped%d %s Write accessSorry, I cannot find %sNo address in this sessionNo address in this fathercReading sessionsNAMESESSION_KEEP_ALIVEREADLOCK_TIMEOUTNOLOCKSYNC_WRITEENFORCE_TIMESTAMPSTITLEGROUP_ADMINACEDBACEDB_CHANGE_MAIN_RELEASEinitialise the databasewdnewtouchedreadlocksThe lock file p-%dm-%dnew-%sNewtouched-%sTouchedStarts-%d-%s%s %s %s %s %s Save session %dgainWriteAccess FaileddropWriteAcces=TRUEsessionDatabaseWritable=FALSEsessionCheckUserName=FALSEname=0getLogin=%swspec=%sgetLoginFailedtestaPARTreadwritenowSaving Session %d at %sSaving done %sSavingAutosaving doneAutosaving alarm cancelledACEDB_NO_AUTOSAVEUser session user set twice%s_%s%s.%d_%s%s/%d.%s.%dWindowID: 0x%lx %s/%s%d%s(unknown time)(unknown user)(unknown program)Created:User:Program:fatal memory allocation error in acedbCrash() termination routine, abortSorry for the crash, please report it, if it is reproducible Could not honour requested switch to new log file.Registering of graph callbacks failed, a NULL callback struct or NULL callback routine was passed.Registering of server callbacks failed, a NULL callback struct or NULL callback routine was passed.// Acedb is running for user %s. // Acedb is inheriting database write access from user %s. WARNING. Your acedb executable has a permission flag that inherits the group-id on execution (setgid). This is pointless, and will stop acedb from spawning external programs on systems with dynamic linking. Use executables with a set-user-id flag instead.Home database directory not found - you must give a parent directory with subdirectories database/ and wspec/ as a command line argument.wspec directory not found - you must give a parent directory with subdirectories database/ and wspec/ as a command line argument.database directory not found - you must give a parent directory with subdirectories database/ and wspec/ as a command line argument.The file "wspec/models.wrm" could not be found in the parent database directory, the database must have this file to be usable.The file "wspec/database.wrm" could not be found in the parent database directory, the database must have this file to be usable.The session class is empty, Reconstruct, sorrySorry, to %s, you must be in the unix group for the password file. Check %s !Sorry, to %s, you must be the owner of the password file. Check %s !Sorry, the database has no password file. To %s, the usernames of trusted administrators have to be listed in the file : %s/passwd.wrmInternal coding error in checkFileGroupPerm() the getgroups() call to find the number of supplementary groups failed.Internal coding error in checkFileGroupPerm() the getgroups() call to retrieve the supplementary groups failed.%s (session %d) already has write accessUnbalanced call to releaseWriteLockreleaseWriteLock cannot unlock the lock fileCannot unlock database by removing database/lock.wrm (%s)Unbalanced call to setWriteLockI can't open or create the lock file %s. (%s)Sorry, I am unable to establish a lock on file database/lock.wrm (%s) There may be a problem with the lock daemon on this machine, esp. if running NFS. To avoid the use of the lock daemon, insert the word NOLOCK in the file wspec/database.wrmThe previous session being delared permanent, I keep itsessionTreeDestroy() - called with invalid sessionTreesessionKillAncestors() - could not find the father he wanted to murder.Error in wspec/database.wrm : the NAME is too long (31 characters max).Error in wspec/database.wrm : smallest legal value for SESSION_KEEP_ALIVE is %dError in wspec/database.wrm : smallest legal value for READLOCK_TIMEOUT is %d hours// Database has non-native byte-order: swappingYou are running %s of the code. The database was created under release %d. Either use the correct binary or upgrade the database. Unable to set readlock for session %d. The database owner should run an acedb program with this new version (%s) to prepare the database for readlocks. The file database/ACEDB.wrm does not exist, indicating that the database is empty. Should I re-initialise the system?Database will remain uninitialized. Bye!Database is being rebuilt by %s - End of this logfileCannot start new log file for new session ! Initialization failed !Not authorized to initialize the database. Check wspec/passwd.wrmCannot set write lock! Initialization failed!Unable to set readlock in database/readlocks/Database Creation failed, check write permissions etc.**********************************************************Making a new database file and starting at session 1 againSorry, the operating system won't let me create %sDestroy this file to reinitialize the database Unable to open last session object from its key: "%s"Unable to get "Date" from last session object: "%s"Session register fails to create the session objectCan't save UserSession object with unititialized StartTimeYou are missing the model for UserSession. To bring your database up to date please Read Models. You will not be able to save until you do this.read the model file and try again.Look for the latest version of the wspec/models.wrm file,and corresponds to an earlier release.Probably, your model for the session class is not correctFATAL, an eror occured in sessionRegisterSorry, while you where reading the database, another process updated it. // You can go on reading, but to write, you must quit and rerun.The database has no file wspec/passwd.wrm. To enable write access to the database, the usernames of trusted administrators have to be listed in the file : %sOn your particular machine, the operating system call "getlogin" failed. To circumvent this problem, you may uncomment the user name "getLoginFailed" in the file wspec/passwd.wrm. But from then on, everybody will have write access unless you set up other security measures using write permissions.%s is not a registered user. To register a user for write access add their login name to the file wspec/passwd.wrmSorry, the program does not have permission to write files in %sCannot find database configuration file wspec/database.wrmParse error in database definition file %s at line %dCannot get %s access to database block file %sFATAL ERROR cached superblock inconstistent with disk : ourSession=%d diskSession=%dAutosaving if %d s elapsed done, last save was %d s agoAutosaving if %d s elapsed not needed, last %d s ago Wrong call to sessionTimeSave, mode = %dAutoSaveAlarm calling sessionTimeSave (%d,0)Autosaving alarm expected in %d ssessionAutoSave in wrong state %dsessionAutoSave(-8) calling sessionTimeSave (0,2)sessionAutoSave(-4) calling sessionTimeSave (0,2)sessionAutoSave(-5) calling sessionTimeSave (0,2)Readlock manager : created readlocks directory %sCannot create readlock file %s (%s)Readlock file to prevent destruction of sessions still in use by other processes Created: %s User: %s Program: %s Version: %s Linkdate: %s Cannot chmod readlock file %s (%s)Readlock manager : start readlock for session %d by %sfailed to rename readlock file %s to %s (%s)Readlock manager : update readlock from session %d to %dfailed to remove readlock file %s (%s)Readlock manager : end readlock for session %dfailed to open directory database/readlocks/ (%s)// Session %d is readlocked by %s since %s using %s (process %d on machine %s) Readlock manager : kill readlock for session %d, process %d on %s is older than %d hours::::::.;.;.;8;g;q;'=1=h=h=h=|=>>>A>A>A>GCC: (GNU) 3.4.3 (csl-sol210-3_4-branch+sol_rpath).symtab.strtab.shstrtab.rel.text.rel.data.bss.rodata.str1.1.rodata.str1.4.rel.rodata.comment4K d- )K % t( /`P 42`PC2,TVn`R ^s4Psgu X  &>#V)n/ARbo y $( ,048<'@3D?HXLm+w9OZ$) bY ;iF&/ B(L Z,a #r"PN@ u8B%Z0j:&S&*pT{qD[2X3Q\`dh`7Ql9pt&x4F|YA7 ksz  s%-6@ELRY_fmu7 B )9BPdoGf ",7@Tbm~Bz ,AO!!ap{      # - ; A G Q b g m |y                 ! 4 > F S \ n y             " 6 > H P ^ m x    -n % %6 %         ?- 6 B +Z n @    y, .     +0/  /(' 5p> T ^ g s          _6& E6p6 06<IS7`m:pD8M?DW?@4"1D@AHOV]dK xsession.c_unameunamestatlstatfstatmknodsession_context_GsessionKeepAlivereadlockTimeoutsuppressLocksyncWriteenforceTimestampsuserSessionUserdb_title_Ggroup_admin_GdropWriteAccesssaveMagicwriteAccesssaveDB_Gdebuglogfile_outlogfile_possiblelogfile_request_new_GgraphCBs_GforceInit_GserverCBs_GwriteAccessChangeRoutinesessionChangeRoutineacedbExitacedbCloseLogacedbCrashmesscrashbufstartNewLogFileacedbLogcreateContextexitContext.0crashContext.1dumpContext.2getOtherDatabaseConfigssessionDoInitreadlockGetSessionNumberscheckFileGroupPermlogName.3showWriteLocklockFdreleaseWriteLocksetWriteLockthisSessionStartTimesessionOedipesessionFusesessionFindSonsessionKillAncestorsdbname.4getConfiguredDatabaseNamepurgeDirectorytheSuperBlockreadlockCreateFilesessionCheckUserNamesessionSaveSessionObjectsessionSaveUserSessionObjectkey2time.5readlockUpdateFilesessionDatabaseWritableresult.6blocksWriteablestatus.7t.8t0.9dt.10timeOut.11closeSessiontimeZero.12sessionAutoSaveAlarmstate.13longDelay.14shortDelay.15readlock_filenamereadlock_status.16readlockCreateDir_nuname_xstat_lxstat_fxstat_xmknodswapDatamesscrashroutinesimpleCrashRoutinewriteAccessChangeRegisterwriteAccessChangeUnRegistersessionChangeRegisterswapSuperBlockstrnew_dbgmessoutmessdumpuMessFreefreemalloc__iobfwriteabortstrcpystrstrtStatusaceOutFlushaceOutCreateToStderruAceOutDestroysessionNewLogFilesessionRequestNewLogFilesessionReopenLogFilereopenAceLogFilestartNewAceLogFileopenAceLogFileappendAceLogFilecloseAceLogFilesessionRegisterGraphCBuMessSetErrorOriginuMessCrashsessionRegisterServerCBsessionGetServerCBhalloc_dbggetContextsessionInitgeteuideuidgetuidruidseteuidgetenvgetLoginprintfgetgidgetegidmesserrorfreeinitfreeOutInitutilsInitdbPathInitmessExitdbPathStrictFilNamedbPathFilNamehelpSetDirmessExitRegistermessCrashRegistermessDumpRegistermessOutRegistermessErrorRegisterblockInitlexInitpickPreInitdiskSetSyncWritelexLastKeysessionStartpickInitprefInitprefReadDBPrefspickCheckConsistencylexAlphaClearsessionInitializeparseArrayInitbIndexInituArrayDestroy_dbgsessionShutDownsessionAdminUserI_own_the_passwdhandleHandleCreate_dbggetgroupsdbPathMakeFilNameaceInCreateFromFileaceInCardaceInNextaceInIntaceInWorduAceInDestroylockfclosefilremovemessSysErrorTextopenerrnothisSessionmessprintfwritetimeNowlexSessionStartbsCreatenamebsGetDatabsDoDestroybIndexVersionlexOverLoadlexReadbsUpdatebsGetKeybsFindTagbsAddDatabsDoSaveuArrayGetdiskFuseOedipeBatsarrayKillsaveAlldiskFuseBatsbsAddKeysessionTreeCreatemessStatusuArrayCreate_dbguArray_dbglexNextsessionTreeDestroyaceInPosfilDirHandleCreatestrcatunlinkdataBaseAccessInitdiskblockreadputsaceGetVersionaceGetVersionStringlexReadGlobalTablesfprintfmessQueryhprintfaceGetReleasedataBaseCreatereadModelsdiskPreparefilopenfilclosesessionDoClosesessionDBTitlesessionDbNamesessionLastSaveTimebsAddTagbsTypetimeShowdiskavaillexDisk_VBatlexaddkeylexSessionEndsessionUserKey_VKeySetlexword2keysessionUserSession2TimeassHandleCreate_dbgsessionStartTimeuAssFindstr2tagassInsertsessionRegisterisWriteAccess_VUserSessionstrncpyexitdiskWriteSuperBlocksessionReleaseWriteAccessexternalCommitsessionGainWriteAccesssessionCheckSuperBlockstackHandleCreate_dbgaceInSteppushTextstackCursorstackNextTextstrcmpuStackDestroyfopenfcloseaceInStreamLineaccessfilCheckNamediskFlushLocalCachesessionForbidWriteAccessreadlockDeleteFilewriteAccessPossiblesessionSetSaveStatussessionMarktimeDiffSecstimeParsesessionClosesessionAutoSavesessionTimeSavealarmsignalsessionDoSavesessionSetUserSessionUser__ctypesessionCheckReadlockmkdirchmodgethostnamegetpidsprintfaceGetLinkDateStringmessGetErrorProgramsessionReadlockAppendFileWinIDmemsetrenamestrchrsscanffilAgesessionSetforceInitexternalServerexternalSaverexternalAliasexternalServerStateexternalServerName XX5YMZe[\8!BdMZhepfy^^^ghij$ k%l/m8ESeZ$_egfo!unopqor^^^h9ov!w!x 0=JO!Txdjs|$fyz&!+|2$7}A!|$}! !09$>JS$X`gs$x$!!g$!!g$#0!5!:!?!DTga$fs!x!}!!g$!!!!g i # ) / ; A G M k q w                    ( > !C |J $O }[ ` e j o t y ~   !  !   !  ! ! ! ! L X  $ e $ e ! ! ! !  $ e g  ; R !W |^ $c } !   ! | $ } g !$ !) !. 7 !< !B T gi y        $ e   !|$}-2F!K|R$W}cht!y!~!!!$g!f !!!%5!:|A$F}O]bx}g$g.3@R[$`elqwg!!f g(-3<k}!e'6!;eCV^djuz !e&>M$ReZv!!!!+6;hu$=KYgoy!!.E!Sfu!d"3!=dQj!rd!d!!d!!"|)$.}Ogjgg!w$!!!!!g!$).m:NVn!s!x!}!!g!$&!Fc$hw!!!!!$d5![q!m  D gd !i !n !s !x  g     ]  c !  $  ] !!!!#!(!4!!9!F!N!S!Z!_!j!r!{!$!!!!!!!!!!!$!j!!!$!"$ ""#"$*"G"$L"\"gg"!l""$""$""!"!"!""g"!"!"!##g'#!.#!3#!8#R#g[#p#$u#~##]###############$$$"$,$5$>$C$J$O$`$e$mj$y$$~$$$$f$$$f$$$$!$!$!$$!$$$$$$$k%%g%!$%!)%!.%!3%=%!E%Q%!V%k_%o%gw%%%%%%%%%%%%!%|& &$&}"&6&!;&|C&L&$Q&}^&!h&dr&&&&!&|&$&}&&&&&&'' '.'8'I'R'Z'd'l'v''''''''''''''''''((((K(X(i(z(((((((((())-):)K)X)i)v)))))!)))))!))))***.*6*;*D*I*T*\*a*k*v***!*|*$*}*******+!++#+!(+7+C+P+U+^+!c+l++!+++++!++++, ,%,<,!A,K,S,c,h,,,,,$,e,,,,,,,,!,--'-6-$;-$@-$E-$J-$O-!T-^-g-w--------- .).9.>.C.L.T.Y.`.e.j.o.t.y.~.........!.f......./#/]/h/!m/fv//!/f/!/f/!/f/ /$/e 00020A0K0T0e00000!0!0!00!0!0f0!0f1g 1!1!1!1#1!(1!.1@1$E1eU1go1g|1!1 11 11 111 2!2-232Z2!v2${2e2$2e222!2!22222!33#3,313A3gW3!\3g3$l3e|3g333!3!3!3!33!3|3$3}3!4! 44g44F4!g4 o444444!4!4!44$44!45!5!)5B5!L5!T5n5!5$55$5f5g55555 66]6c16B6G6$L6ff6l6v66666666 7777'7,7B7H7N7S7_7e7o7!t7|777!7f7!777!7f777 8 88(848 >8[8~888888888!88$8f999 9#9!(9f69;9U9$Z9fl9!q9|z9$9}9 9"9$9f9!9  ::#:"+:$0:fB:!G:fY:!^:f:!::::S::!:|::$:};;#;*;S@;$E;fT;!i;;!;|;;$;};;;;<!<|<<$<}<0<M<_<!d<|m<r<$w<}}<<<<<!<|<<$<}<==#=S3=C=$H=fW=!j=~==$=f=!=!=|==$=}==> >S>%>/>C>M>W>>!>|>>$>}>>>>>>>>??!?$?0? 5?C?Q? a?q?!v?|}?!?}?&?!?d???@ @@#@+@%7@<@E@N@W@!\@e@z@@@@@!@@@@@@@A!A!A*A?A!FA!KA!PA]AnAgA!A!AA(AAgA)AAgBB$Bf%BgJB!QBaBB*B+BB!B!B!BB!BB,BBBBB$BjC CCg/C-;CCC.NCZCbCkC$pCCCCC)CCC$CjCCCCDD$ DfDg9D!>DCDWD!]DeD}DSD0D!DDDD*D+DD!E!E! EE! E,)E.E1FEFQFVF$[FfF!FFgF!F!F!FF!FGG$GPG!dGG!G!G!GG!G,GGG2mH!sH3H!H3H!H3H!H4II!#IBI!LI!VI!aI!fI!lIII!II!IdI!J,J!8JdNJ!iJJ!JdJJ$JJJ K"K$'Kf^KgxKgK_ (!  $(,048<@DHLPTX\dbpath.o/ 1133374748 530 202 100644 4480 ` ELF4( UuUuU u ujU u ujU u ujUuu ujUS]=tj-h$ u h%ÃOjh+h.S=#jAhj 5h/PP$8t h8zh+h.hEt jh+h.hE<h+h.hVtjh+h.hV hgu55hw=t5h]UWVS }hhjhƃ=u!hh$5Vt ?thVWV} t%E 8thVu VuuuhhjVPÃtt V= V5Vt ?thVWV} t%E 8thVu VuuuhhjVPÃt V؍e[^_UWVS u} hhjhÃ=u!hh$(5St >thSVSt ?thSWSuuuhhjSPƃt Se[^_UWVS u} hhjhÃ=u!hh$X5St >thSVSt ?thSWS}t%E8thSuShhuhhjSPƃt Se[^_dbpath.crepeated call to dbPathInitACEDBrdACEDB=%sACEDB_COMMON/usr/share/acedb/usr/local/acedbACEDB_NO_BANNER// Database directory: %s // Shared files: %s /.called dbPathFilname before dbPathInitcalled dbPathStrictFilname before dbPathInitcalled dbPathMakeFilname before dbPathInitGCC: (GNU) 3.4.3 (csl-sol210-3_4-branch+sol_rpath).symtab.strtab.shstrtab.rel.text.data.bss.rodata.str1.1.rodata.str1.4.comment4 h  %8+8028?2Ng4W p   L &>"V(n.5?GNV^fq1 &:#dbpath.c_unameunamestatlstatfstatmknoddbpathcommondir_nuname_xstat_lxstat_fxstat_xmknoddbPathInituMessSetErrorOriginuMessCrashgetenvfilGetNamemessprintfstrnew_dbgputenvfilCheckNameprintfdbPathFilNamestackHandleCreate_dbgcatTextstackText_dbguStackDestroystackCleardbPathStrictFilNamedbPathMakeFilName 5Me       $-6= BQ V[h m r w             C O Zj ov{! !! !! "#1A$JP!d j!t! !! "#  ( -49EK!_ e!o! !! "#   !(-9?!S Y!c!w }!! !!  "#aceutils.o/ 1133374748 530 202 100644 1932 ` ELFt4( UuUuU u ujU u ujU u ujUuu ujUWVS } EjjPEUE؉U܃ j;hjuƉ>t:; uPh WCC;u݀8tPh Wt VEuuP e[^_U haceutils.c// %s NB: changes made since the last explicit save have NOT been saved GCC: (GNU) 3.4.3 (csl-sol210-3_4-branch+sol_rpath).symtab.strtab.shstrtab.rel.text.data.bss.rodata.str1.1.rodata.str1.4.comment4\  %+02?2CN4W,   &>$V*n08?GOWiy5'aceutils.c_unameunamestatlstatfstatmknod_nuname_xstat_lxstat_fxstat_xmknodacedbPrintMessagemessOutRegisterstrnew_dbgaceOutPrintuMessFreesimpleCrashRoutinesessionReleaseWriteAccessreadlockDeleteFilefiltmpcleanupmessout 5Me   &<AFN Sbanner.o/ 1133374748 530 202 100644 8848 ` ELF4( UuUuU u ujU u ujU u ujUuu ujUVS jZhjjj@ƃ j^hj Puh Pj^hv V jbhj PPh$Pjbhv V }jghjhjghv V jhhjh4jhhv V jihjhljihv V jjhjhjjhv V jkhjhjkhv V johjhjohv V jphjh4jphv V jqhjhpjqhv V jrhjhjrhv V jshjhjshv V } phhjh$hhv V hhjh>hhv V hhjhhhhv V hhjhhhv V hhjhNhhv V hhjhhhv V hhjhhhv V hhjh<hhv V hhjhYhhv V hhjhdhhv V hhjhhhv V hhjhhhv V hhjhbhhv V hhjhhhv V hhjhhhv V hhjhHhhv V hhjhphhv V hhjhhhv V hhjhhhv V hhjhhhv V hhjhhhv V hhjhjhhv V hhjhkhhv V hhjhLhhv V hhjhhhv V hhjhhhv V hhjhhhv V hhjhHhhv V hhjhxhhv V hhjhjhhv V hhjh|hhv V hhjhhhv V hhjhhhv V hhjhhhv V hhjhjhhv V e[^UWVS(hhjjj ǃjhhhh  5P PhS jShƃtR4hhjV$hhw W Vu Vt e[^_UWVS}hu8 ~-W St SF9w ӅthhWe[^_banner.c **** Program %s, %s ******** Using %s, %s **** Montpellier: Sanger: DKFZ: LBL: and also: Thank you et merci.at the above email addresses.rwrmdatainfowspec%d %d %dACEDB_NO_BANNER** Acembly: Sequence Assembly and Edition system by Danielle et Jean Thierry-Mieg and Ulrich Sauvage (CNRS, France) mieg@crbm.cnrs-mop.fr Built over the acedb data manager, developed by Thierry-Mieg and Durbin (1989-...)Code by: Jean Thierry-Mieg (CNRS, France) mieg@crbm.cnrs-mop.fr Richard Durbin (Sanger Centre, UK) rd@sanger.ac.uk Simon Kelley (Sanger Centre, UK) srk@sanger.ac.uk Ed Griffiths (Sanger Centre, UK) edgrif@sanger.ac.uk Rob Clack (Sanger Centre, UK) rnc@sanger.ac.ukwith ideas and code contributed from many laboratories including: Danielle Thierry-Mieg on the user interface Michel Potdevin on more-info, biblio and debugging Erik Sonnhammer for the blixem and dotter packages, Friedemann Wobus on AQL and the graphic package Ian Longden on graphics applications Otto Ritter on large data sets and the attach mechanism, Detlef Wolf for quality control Petr Kocab and Martin Senger for rpc layer; Franck Eeckman for the Mac port John McCarthy on metadata and documentation, Gary Aochi for the query interface UC Berkeley Drosophila Genome group: Cyrus Harmon also for the Mac port Suzana Lewis on the graphic toolboxUniversity of British Columbia, Canada: Richard Bruskiewich on the Microsoft Windows port. Phil Green (genefinder), Jaime Prilusky (Mosaic help), Sam Cartinhour and John Morris on documentation. This list is only tentative, we apologise for omissions, and wish to stress that these people and others have also helped fix all sorts of details that cannot be listed individually. You may redistribute this program and database subject to theconditions in the accompanying copyright file. Anyone interested inmaintaining an up-to-date version should contact one of the authorsGCC: (GNU) 3.4.3 (csl-sol210-3_4-branch+sol_rpath).symtab.strtab.shstrtab.rel.text.data.bss.rodata.str1.1.rodata.str1.4.comment4   %L +L 02L ?2( HNp4W  T &>"V(n.6=EMU gx  (0DMWeo w{banner.c_unameunamestatlstatfstatmknod_nuname_xstat_lxstat_fxstat_xmknodbannerMainStringsuArrayCreate_dbgutAppGetCompileDatemessprintfstrnew_dbguArray_dbgaceGetLinkDateStringaceGetVersionStringbannerDataInfoStringsdbPathStrictFilNamethisSessionaceGetReleaseaceGetVersionsprintfaceInCreateFromFileaceInPosaceInCarduAceInDestroyuMessFreebannerWritegetenvputsuArrayDestroy_dbg 5Me       # ,B I NW `l s x            %. 7C J OX am t y          ( / 4@ IX _ dp y           $0 9H O T` ix             )8 ? DP Yh o t          ( / 4@ IX _ dp y           $0 9H O T` ix             )8 ? DP Yh o t             (  /  4 @  I X  _  d p  y                  !0  8 "@ L  U c #s $ %  ' ( %   )queryexe.o/ 1133374750 530 202 100644 47100 ` ELFt4( UuUuU u ujU u ujU u ujUuu ujËD$ËD$rv&wøËT$twt0t øUWS=u"hh1jdP@;hh1jd@PÃ=dOtPP;Ps @-hh1j5@@Ou%dPP ;rA'hh1$<؍e[_US]P;Ps @-hh1j5@@ ]ËD$D$UWS(= u"hh1jhP  @;hh1jh@PÃ=hOtP P;Ps  @-hh1j5  @ @ Ou%h PP ;rA'hh1$<\$؍e[_US] P;Ps  @-hh1j5  @ @ $]Ë$D$(D$US]tB{t s{ t s C C S]UVS]M ut9,t0,84408rvw08t@08ShQB08#B08 B08"r@08 ]@08 H0~$=8#0@00@0(t-(t &)t ShnAIu 08=80@00@0{t-{t &}t ShjAIu 088=8+0@00@0[t-[t &]t ShAIu 08=80@0088"ux\u$0P0xx"uz\tܡ088HSh BShD'Shl =80=80B0z=8=808 =8|08%g=8Z08E=880B0z=8=80B0z=c8$q8?}8!=80B0z&uB0808|u@08n08^u@08R08-u@08608/u@0808=u@08=8980H=80B0z=uB08$=80B0z&uB08l=8_0B0z|uB084=8'08=80800+t"+ *ty-t/=80:t1B+t+ t-t 0ى0:uσ&8W=8uN08(<=8u308)!9u800048e[^US]StU)EPEPt ؀}uE‰Ћ]UWVS,EEvEehh1Upu PhE+hh1vu P4hE hE hh1vu P4hE hh1vu P4hEU hh1vu P4hE h<h1su P4hE hKh1vu P4hE hjh1su PhXEf hoh1vu PhE1 hh1vu P4hE hh hh1vu P4hE h)h1vu P4h$Ej ;!u{tC8 t 8u 9Xu[ u֋Mt'{tu CP[ uًEދ{ t[ 9w 't9uރ{ uw7t, t r wM[uԃ w)Mt; u޺ [ uv EEEuEE ~  hh1F pu 8*t8?u @8*t8?tIT hh1vu P4hPE =~ hh1F pu 8*t8?u @8*t8?tIhh1vu P4hE uH~ ahh1vu P4hEu`~ F 888%hh1F pu PhEY/~ ^ E5EPh&h1su P uC/h/h1su Pu$t uCuPh2h1su PtW u Ph5h1su PhEP51};/jhDh1vu P4h<E a~ ^ E5EPhTh1su P uC/h]h1su Pu$/ u.CuPh`h1su PtW u Phbh1su PhhEP5';/{Eu E~ tF 8 u>h~h1vu P4hE^ ;Ehh1su Pu$t}EC uPhh1su PtS u Phh1su PhEPj73ug;u{tC0uK hh hh1vu P4hE EBփG^ M;Ehh1su Pu$t}EC uPhh1su PtS u Phh1su PhEPj7;;>*u ;hh1vu P4hEB uo~tG.‹FBF B rVF ztBPz tB P~KF8 ?E3&wt~tF8 t8&t8't 9ptE~ t F 8 hh1vu P4h<EP~t F8 t9pu>hh1vu P4hhEE~ tF 8 u>hh1vu P4h<E>0u F 8ƒ}t!^ tC Z SC F tp}t9FM9u1t)HBP@ t9Auq9A uq Nr~uV} EEe[^_UWVSEE}tE8u uEPj`}uE}tU܉B M܉HE܉$hauuudhuu}?hWuuE h\uuU hQuuM EƉ8uE#EƉ8uE%xEƉ8uELEƉ8uE EƉ8uEE Ɖ8uE/UU؉кƉ׉8tSEغƉ׉8t9EغƉ׉8tEغƉ8uEBE Ɖ8uE*EƉ8uE+EƉ8uE-EƉ8uE.EƉ8uE,fEƉ8uE:EƉ8uEEƉ8uEEƉ8uEE Ɖ8uEEƉ8uE^E Ɖ8uE2hquuU h|uuM=t%hhuuuEƉ8uE"EƉ8uE!bEƉ8uE 6EƉ8uE EƉ8uE@!EƉ8uE@ EPEPhuuUEB,jEPut EM܉A u u }܉Gut3Pu " u U܉Buu uEPuÃ#Ee[^_UWVS} uVWuà VWP ؍e[^_UWVS ]u }t[Hv;uG;t ;uPVh h1sVPpCtX[ ue[^_UWVS }u ]~tSvWF~ tSv WF >0~ u=h#h1vWP4h~u=h*h1vWP4hF 8uF0uJ hh h1h1vWP4h \>uU~ t0h=h1jWPh~t^FC V؃e[^_US]tO;\u6{t sC s$t ;\t]UWVS ]; uC; tt;t S,+u |hdh1jэLIQFSP jvSF jvPtcvFPtMEEPvv:F}t VE &E 0 VE e[^_USE] EʹE@u܀E@t! Eu ʹS$ E@uڀE@t Euظ؉؅ٺu Eu غٺuEu؉ٺuEu غVٺuEu؉0؃hh1Sh]USM] UC$<RQRQRQ|RQeRQSRQ?RQ(hh1Sh(]US]=<t 5<<thh1jS<]UEU w :u#<=< RPUWVS\] }uE=dt?>0I$X hP hf hL h2 h~ ~ vWSut#rtKSv WSuƒv WSu~w~ hvWSurtEt6Kv WSuH  v WSuƒ~~ vWSut@rt@rv WSuvv WSuXMB~ u hX"v WSu,~u h~ t<hPh1vuP4hvWSuƒu~f~ WFE0tAuWSuM%uMF@FVU2uWSu=d?u SvWSuEPF80 P7}uEPjj 7tE}uEPjj 7tE~}u)EPjj 7tERP,$d$O}w?EPuj 7t( u]EـE@u غ^{~ l~tF0tF 0u :~t(vWSu> v WSu't='w &t(tH)tZF @~tF@^rF @~tFh-^SF @~tFH^F E0t*Ur6EpЉƒ F8t Yhh1F puP6hh1FpuPЉƒs VUB v9 jU9Bs$?uFpS) =d ?u S Fx!uEPj 7u8^ j9CEPFp7}u^F 0VEPjj 7<F p6Ed$$"; }uWF 0EPjj 7F p6u }Xhh1F puPÃuEPuj 7Z$SujЉƒQ Sujƒ1 SujЉƒ Sujƒ SujЉƒ Sujƒ u#=lt h2l| }EPuj 7)F 0t9EPhJutF p6u hh1F puP6u{ E~F 03t9EPhJutF p6uYb h(h1F puP6u5 EPuhEPj"7t ~~ vWSu=d?u S=`tmB;Bs%j7R@:h>h1j5j7R@E 7tv WSu E=`tRPP ;rA#hCh1$<P7U~~~ ovWSuyRG=d5F 0F F @}fEҴ fEm]mҺ}=d?u SM}t j!7M}u=dtvSƒe?u SEv7(~ v WSu#ƒ~ =dt<~ t$F 8upS=d~ tgF 8u_hMhxh1puPSt@ ^thzh1PAv WSuKt?u Su EPj!7uFEE;tEEPj"7uE^~ ?uF pSsF pS7R=d@?u S EPF p7]]E}uEPjj 7tE}uEPjj 7tEv}u)EPjj 7tERP,$d$G}EPuj 7tl u]EـE@tDE}u U]]2]EEuU]EEuUE]؃EPj"7},t,w+t*-t.tE^Eu^ ^E^x~t@F8w $4~ Rv WSu\ƒ;EkEEE4Ephh1vuPuuEPSu}t~ tv WSuƒU~  EiEE4whh1F puPuuEPSuU~  F pǃu#F pSЉƒx ~0h h1VW0SF9w к|unv WSuxƒZh h1vuP4h ! Ѝe[^_UWVS u }u hN Kt j Ku a}udP4hg>u$~t vPhk'>/u"~t vPhv~t)h8h1vuPh j ~tjGPvu~ tjGPv ue[^_UWVS} ]ujtc;u^dVSWutrt5dudd=`uQVSWuBtr4t#(hTh1$Ѝe[^_UWVS}EEu!hdh1$Dhfh1j5G E=`9hkh1SW0t% ؉љut `gEu EPVuNthth1uEW0}t uEC=`u ;]ZEG e[^_UWVS }] E w tt\{tusWthh1W hh1jjj thh1W hh1jjj K}{tusWE{ tus uEEhh1jWƃ usWǃ;u'x t!thh1Vus Vvƃw_$VWEFVWE4VWE"VWEVWEthh1Wthh1VEe[^_Uhd$h1jjj UWVS(h h1jjj E E}t E@ EEEU B E8u@E`h h1j5;uh h1Vut љu u}uSquSjX SEAEPuutf}tHh h1uEuU&}t h# h1uEuUURj"uuƒ uE=`E`M q EPSut\}tVEPj!ut>}t h5 h1uEuUURj"uuƒ uE=`F;u/huuM ytuqu}thA h1uEe[^_UWVS(hJ h1jjj E E}tE@ E`EEM9MhP h1uu;}t Eљu uhjSǃt]x ~8h^ h1uEuh^ h1VW F9w ȅth` h1WEE9E0huu}thf h1uEe[^_UWVSho h1jjj EEUB xWÃx ~WEh~ h1VFuUEPh} h1WS0uG9{ huuExtu puOEU9=EPtz tB 8t hEh h1B pu ÉIw hE u ƃhu Su hu }th h1uh h1Vu PjPh h1VFuUEPWuЋUztu ruEe[^_UWVS u] ;u{ t[ ;u{ u;]${ bC 0 MuSVSuSV> V-{  uEh h1C puI vqhuSuhuh h1uuPVÃth h1Vsth h1V h h1jjj 9{ tk=tbh h1C pu‰Iv1RVÃth h1Vth h1V h h1jjj th h1V{ ~C 8/r{TC8 Hx >@ 8u4x t.p >u&~t u9F} C@ p u>Cp >~ u9FCp E h h1jjj E h h1vuƃ C pEPVt$h h1juUEJ>t>*t>?tF>t>*t>?u>uE}th h1uuS h h1jjj th h1V{ C 8uSuSVvth- h1V h$0 h1jjj 3tuSVH h9 h1jjj e[^_UWVS hE h1j(5@@uFE\u>F"uÃ[[()w{t!{]_}Q@P;Ps}@@3hP h1j5@@@}@@@P;Ps]@@hQ h1j5@@@]@@@P;Ps)@@hR h1j5@@@)@@a@@;@PP @;rA&hZ h1$<8FÄ+ @A;v]uQQ @;rA%hf h1$<PhwtnuhTEuPhE)EuPhEe[^_UVS]EEPu t$EppSƃuth h1Se[^UWVS Eu E=tDh h1jVjjPjE t SECt.xu%xtxuh h1jPL=LuM` h h1jj5 h h1jP5DD 5DÃtV5Duh h1S5DP$ _ÅtT8tOh h1jP5HHSPh h1j5HPWEǃ=`u Vu Vu}u h h1jjj E L=L X KtN Q<t4h h1Q4 PKu= t%h h15  Ee[^_U=Pu h h1jjjP h h1j5PU uu 5PUVSt jjjjӃuu uƃt jjjjӃe[^UWVS,] h h1jQljCEt:ƒ t\uU:tBEA *AAUBEuƃ h h1jjj EE =`Í,EE uEt`Wut}j h1SuEE1WuthB h1uEVUEPuuC=`M9Y {=`Í,EE}t& E܉љut `tE1WuthW h1uEVUEPuuE܃=`u+EPS`=`u K}~hV4$=t_EEjWjjÃPuEthg h1S}thh h1u}t/]SuEthp h1SuVÃ}tht h1uthu h1Vt W؍e[^_UUt)EPRt uUWVS }t  t7t_ EEh h1j5 ~g}tjupEPu pt+h h1Puك C9_ }u}t uEUz te[^_UWVSujV4$tiUEPSth h1WGu U#h h1ShL VÃue[^_UWVSujV4$tiUEPSth h1WGu U#h h1Shx VÃue[^_UVSu ]t@=Tt 5TThTStm*=Tu!h h1$Tt.`TpURVpl`ƒЍe[^UVSu ]t@=Xt 5XXhXStb*=Xu!h h1$t-`XpuVp`ƒЍe[^Uu uu uUEUtu&`pu RpD`Uuf uu uUWVS]u }EEEu%u!h: h1$  StcEPStOUZ;uDSEPjrSt.tC}fE fEmm tCE uEe[^_UEpURu pUVSC t PC Nuԍe[^US ] EPutU$Ћ]!&-49=GQW\ahq|  & @ @ @ @NULLQOPSUBQUERYSUBEXPNAMEDSETTEXTCALCULNUMBERTIMETAGFINALPIPEPIPEQUERYWHEREFINDFROMFOLLOWWEBQUERYNEIGHBOURSGREPEXPANDORXORANDNOTSETELSESETDEFINESETORSETXORSETANDSETMINUSCOMPOSITE_TAGISLTLEGTGENEQEQLIKEPLUSMINUSMULTIPLYDIVIDECOUNTAVGSUMMINMAXCLASSVECTOR_TAGqueryexe.cUser stack underflowUnbalanced double quote: %sUnbalanced parenthesis: %sUnbalanced curly bracket: %s// Should be tag:number#tag Autocompleting >%s to >%sIsSELFSelfNEXTHERE%f%cNothing to the left of %s: %s// Should be tag:number Sorry - not a good date%f cdtDumping NULL < > %s: tag = %s class = %s cp = %s inconsistency in condFMatchk*Missing final %c in: %sMissing final " in: %sUnbalanced %c in: %sMismatched %c in: %s /%\@Unbalanced square bracket: %sUnexpected closing parenthesis: %sUnexpected closing curly bracket: %sUnexpected closing square bracket: %sTwo occurences of FIND/FOLLOW/FROM in %sNothing to the right of %s: %sWEBQUERY is not available in this version of acedb, sorryCLASS Missing or unrecognised at %s: %s Missing or unrecognised Class #%s# after FINDSorry, parsing error after a FIND in: %s// Please use table maker for more complex operations Sorry, unrecognized expression to the left of %s: %s Sorry, kernel error while parsing %s: %sThe text to the right of GREP should have at least 3 characters %s: %sThe text to the right of WEBQUERY should have at least 3 characters %s: %sIS must be followed by a text or a comparator: %sAutocompleting CLASS %s to CLASS %sMissing or unrecognised Class after %s: %sAutocompleting FIND %s to FIND %s// Should be FOLLOW tag or FOLLOW tag#tag Sorry, unrecognized expression to the right of %s: %s %s%sAutocompleting ... %s to ... %sUnrecognised expression after %s: %sMissing expression to the right of %s: %sMissing expression to the left of %s: %sSorry, unrecognized expression around %s: %s Warning: Please reformulate your query, the () are bizare in %sUnknown operator %d in condCheck.Unknown operator %d in condCheckText.Internal error : condMatch should not parse FOLLOWInternal error : condMatch should not parse WHEREInternal error : condMatch should not parse FINDSorry: set operation FROM not yet implementedInternal error : condMatch should not parse a SET operationInternal error : condMatch should not parse NOT with nothing to the rightInternal error : condMatch should not parse a subexp with nothing to the leftInternal error : missing operator at %s: %sConfusion in condMatch at: %s: %squery filter received a null ksSorry Named Sets are not yet implemented, please complainFIND Text should be followed by a Text, try to "double quote it"FIND Text should be followed by at least 3 charactersNAMEDSET not yet coded, please complain, sorryBad condition %s in subclass definition Bad condition %s in constraint definition First call to queryFind must give a query textFirst call to queryFind2 must give a query textqueryCalcul received 2 void pointers  4 % L   E    < g!!!!!!!!s'&]'4'&&o&=(&(c(O((''>)3,)<,<<8>>))))>)>> *.+*+))))))6=///////....9{:{:{:{:>73T424433<<<<<<<<<<<<<<<<<<<<<<<GDWDCD#D5DOOOOOOOOOOOOMTOKLKKKOOOOOOOOOO-Q={Gzd??GCC: (GNU) 3.4.3 (csl-sol210-3_4-branch+sol_rpath).symtab.strtab.shstrtab.rel.text.rel.data.bss.rodata.str1.1.rodata.str1.4.rel.rodata.rodata.cst8.rodata.cst4.comment4a d#) bp % </ch42cC2f) VoR į8^sktxt4$V*n09`IU Zg"p-|d2\ $(h8\bAU ,04'8-v5 L?X J0\&"3oY"~y"(P %'l<(Q(@ 8)d+?=h@FA2`xB,_K9D,CDOG|bINm@s&SqDHLPTX )4DXcum(xq$b(7$ EQ[epyEVd)2IVafnu,5?FNVXiySVL[=\ ]-]=Q^G_R_$^_Ci3`$uW`3a Sa=a=queryexe.c_unameunamestatlstatfstatmknodbitFielddoPushPopSubObjsubObjMarkssubQwebQueryFuncisNumberisLocatorOpfreeCDTstacknCDTusednCDTallocblocSize.0CDTallocCDTfreefreeCONDstacknCONDusednCONDallocblocSize.1CONDallocMAGICCONDfreecdtDestroypreviousText.2cp.3backup.4qop.5cdtItemgoodClasscdtReordercdtConstructLevelcdtConstructExpandcdtExpandcdtRemoveSubExpcheckParenthesescondCheckcondCheckTextwriteMessmyNamequerySetTextNamemyNextNamecondMatchfuzzycdtDumpcondFMatchqueryFilterdoInterruptquerySetOperationqueryExecutequeryFromqueryExpandqueryExpandKeysetsqueryClassbra.6querySingleCommandmyText.7runningText.8subQueryLevel.9s.10cond.11cond.12_nuname_xstat_lxstat_fxstat_xmknodqNamequeryFindCondqueryRegisterWebQuerystackHandleCreate_dbghalloc_dbgstackExtend_dbguMessSetErrorOriginuMessCrashCDTstatusCONDstatusmessoutpickIsCompositepickIsAstackText_dbgmesserror_VClasslexword2keynamepickMatchstrcasecmplexNextsscanfstackMarkfreeunprotectpushTextcondDestroyuStackDestroyinvokeDebuggercondConstructregExpMatchlexstrcmpuMessFreestrnew_dbgnextNamebsCreatebsGetKeyTagsbsGetDataatoflexMaxbIndexFindtimeParsetimeComparisonbsMarkbsPushObjbsGotobsFindTagqueryKeyParametrizeduArrayDestroy_dbg_VCommentbsIsTagInObjpickListpickMatchCaseSensitivelexIsInClassuArray_dbgputsputcharprintfbIndexVersionstackReCreate_dbgmessIsInterruptCalledbsDoDestroyuArrayCreate_dbgarrayCopy_dbgkeySetORkeySetXORkeySetANDkeySetMINUSbsGetKeykeySetOrderarraySortarrayCompress_VKeySetuArrayGet_VTextcatTextqueryGrepkeySetNeighboursoldSetForServerqueryParametrizedexternalServeruArrayReCreate_dbgfreesettextfreespecialfreeposfreecardqueryLocalParametrizedcondCheckSyntaxqueryIsAqueryIsAInitstackCursorstackNextTextconstraintsInitqueryFindqueryFind2queryFind21queryFind3queryFind31queryCalculqueryCheckConstraintsqueryClearConstraintsqueryConstraintsInit LL5MMNeOP T5 <HUS^m} V W X $3C KPVXblw T U$ ,1V9CV[j W X V *6# ([=CTZkq'  [)/>JP\e [%[!'6BHOhq%[%[%[ (8GTZiv| ' 4 < J P ^ i o z                # + 9 ? N [ c q w             : G s }               \4 ]  ^ % _  ^ Q % _ % [#  . ^; Q@ %E [a  l ^y Q~ % _  ^ Q % _  ^ Q % [ &^3Q8%=_Y d^m%r[ ^%[ ^Q%_%  ^&Q+%0[L W^dQi%n[ ^ ^Q"%'[E` n^ ^Q%[ ^Q%[c q^z%[` ^a  ^$b,cLb] h^qdb ^%[`e ^Q %[F`W b^ka ^bcb ^ db0 ;^D%I[[``e ^Q%_ ^,b4cRbc n^wdb ^ [e%% ^-Q2%7[ ^bcb ^db ^$%)[<et ^Q%[f q^~Q%[ ^Q%[  ^"Q'%,[o'w d d d d  d0 \     = ] w     B n     J v   d d !  ) dF  r     #! U! ]!f!a!g!h!i!g!i" "^9# B#^O#QT#%Y#_|# #^#Q# #_#%# # #^#Q#%#[)$ 1$^:$%?$[$$k$$l% 7%TD%i%j%jB&/k&'&/' 'W'%'X'''c'n(c,(oC(oU(oi(o( (W(%(X(((p(( (q())/)rS))')%)[)%)[)%)[)%)[)%)[+%+[=,%B,[b, m,^z,Q,%,[`-u-s-t-u.u".uR.ud.vx/6/6/6G0 U0^^1 l1^1 1^1w1x12s?2tS2ws2t2u 3uV3 d3^m3y3u3'3z3z3z4z<4z^4zz44 4[44u4 4f5 +5^t5 |5f5 5^5r5te6z6s666{666 66V6{667|37>7M7d7 i7Wp7 u7X7}7?8T8s{8~88x8s8~09M9xh99 9 9^99 99s!:tK:`:t:x:::s;tH;ul;u;u;u;vD<t<' =$= /=^;=== =^=)>\A>m> t>>> >^>Q>%>[D? I?a?r? }? ??Q? ??b? ??b? ?? @^@ @%@}@@@@@@A AW$A )AXmA rAWyA%~AXA AAAAA AAA'B 3BIBZBB BB BC C,C 7CC CC CC'DD)D;DMDdD jD~D DD%D[D DD D&E9E AEFEKEfE oEEExEEsE F F3F AFZFlFFFFF FGG G5G=GHG{G GG GGH HH=HIH QHoH }HH HH HHHHH H I +ILI\wI II IIeIIIJ*J%/J[DJ RJ^sJ%xJ[JgJ JiJJ JJ JJ J^J K K,KeK'KLgL L^@L HLiTL\L dLnL yL^LL LL LL LLL M^.MDM JMeM kM{M MM MNg>NglN wNN N^NaN NO O=O HOaO gOO OO%O[O OP PY[YclY xYYrYYYZZ6ZcGZ SZjZrzZZeZZZZZZZ[ [$[ ,[D[[[ a[p[[ [[ [[p[m[jL\ T\Y\^\\}\ \\\*]2]H]mY] c]z] ]W]%]X]]]]m] ^^ ^W&^%+^X7^b^n^s^jy^^^m^^ ^W^%^X^^R^^^%_1_6_j<_K_Q_me_u_ z_W_%_X____ `&`N`` `W`%`X``m!ajeauajama         $ ( , 0 4 8 < @ D H L P T X \ ` d h l p t x |                    $(,048<@DHLPTX\`dhlptx|  $(,048<@DHLPTX\`dhlptx|  $(,048<@DHLPTX\`dhlptx|  $(,048<@DHLPTX\`dhlptx| tabledefsubs.o/ 1133374751 530 202 100644 25576 ` ELF94( UuUuU u ujU u ujU u ujUuu ujUWVS ]}ujmh $jju SÃtyjWSPtjwh jWjxh jS$ x u V Se[^_UWVS }u à Wt 8/uhh jP jVWSthh jVx u S؍e[^_UWVS u yÃjjhh juPjVPS thh jVx u S W؍e[^_UWVS} uÃƃjjhh jSPEjWPV thh jWEx u V ut Se[^_US](;t!hh $0t9t0t'tCDP0, ǃ$Fǃ$t $ǃ$ t ǃ t ǃt S]ËD$UWVSuhh jjp ǻ ƒx ~7ЉP|th h SWC9Z ɉe[^_UWVSuhh jjp ǻ x ~4hh SWJT 0C9X ̉e[^_UVSUx u h`Ckt h{ u h{xt8CxPhPu hbh CxPs Ph!PjÃp PƃthDh Se[^UWVSEE @ EEE}tUU}~EEtE= U, Rhth jjdƃjPÃES$4$Ãut V7h,Vh~h jVPVhh SVPUt V u }uEhh j5Eǀ(Uƒx ~GB{8t(hh jds8C8h@PFE9r  UEǀ$#$} utt}U9}jGEhh Wu  ƉXX$XPu-"4$AU(u}t M}~ EG;}|E UǂE9E|E}t}u ul }tEUEЍe[^_UWVS]hh jjj Nj x u!hh $${ {xt#CxPhPtth s PhEPu ƃ{xth CxPVǃǾthh VЍe[^_UVSutL~uC~t=^ Kt FP Kuthh Ve[^UWVS u hh VE@,@@0@0 @@@(@4@@ @ jVu jVu jVu{<Cx hhjP hhjPE@؍e[^_UWVS } h-h u E$ku h1h VUà M@ H;E ~,؁thtSPFU@ H9ԋMH u 9p ~IGh=h VR9x4~H49x4uFPh\FE9r UBE He[^_UWVS }u6t-t$t hN/ W=hbh jhƃjPÃP$4$Ãut VhiVhlh jVPVhnh SVPt VA WÃt*jPW hzh Se[^_UWVSEEENjR JUkLJTLJPG4H}~u;E}y!uAPh&UPD u0kt+Kt&nt!APuhtu.8u(hh jdw8G8huP,hh jw,tkEPhh jw,Pu2hh jw,Ph{"EP\$u EDEPw$$u& w$Ph{EP _xSmHLJTuPtxjEPSuSh{VET-_xxt|;%uq{%uSuhKC0< wtBA0< v~;u~SuhPC;uhh jhÃGxPS$EhS;u}aUPDK)w>$hS$hShSF;u|hh uSPhh jSP$$EPS Vuۃhh uSPuAhh uSPuht S5t SLJTEtM}e[^_UVSu EjFDPÃ5EPS$}tvjuÃt` uPhdžE t dždže[^UShXh jh0$[h jhtjCǃǃǃ ǃ ؋]US]{8t s8C8{,t s,C,]UVSEp Nt? PTǃTǃPtNue[^UWVS }u hh jGDPÃu~CS+B1DSB9W0+F0C~N9t K+B1DKAB9WSW<$t Se[^_UWS=u< hh jh@;hh j@PÃ=OtPP;Ps @-hh j5@@0OuࣄPP ;rA'hh $  ؍e[_US]={(t s(C({,t s,C,P;Ps @-hh j5@@ ]ËT$t:tB<%uÀ:uUWVS ]EC@c$hh j s$hPEhh jC$$hPExhh js$PhPEu!hdh $w,V" Gx uiuQGx,t!hlh $u# G pC(ƃqGp,VtjVu'Gx$tp$s G pC(PGPs(u# G pC(ƃ!,Gxbtxts}}}v}g}X}I}:G@K)Q$8,uEPj Vu}}IE;t;u7]ESj V}E;t;t̃}EGG$,uEPSVu d"EE;t ;tEԃEPSVuԺ}EԉG$EPSVe}jE;t;u7]ESj V}3E;t;t̃}EGG$EPjSVEG$EPjSVEG$rEPjSVEG$REPjSV}tE܀8u"Ӄ Gp8G$u܋Gp8Gx@$G@ft0fdtLiiud}t];]~EEЋ]Љ_$V}tEEEuE]E_$0}tE;Ev]]EG$6G@ft0fdtNkiuf}t];]}EEЋ]Љ_$}tEEEuE]E_$}tE;Es]]EG$G@ft,iuO}uE]]ЋUBEЉәG$D}u]EEUȋE@P4$d$_$AG@ftqi}uEEG$EEEẼ}EEP<$d$mm}fEڴ fEm_$m}u UU_$EEUEEUă}~gum_$V~G@ft iu4}uEEEЋ]Љ_$$}u]EEU_$ 3EԻ"w,VG,4$GЍe[^_UWVS u Fxx‹HEu F@K) $Fp v^FFhTh j v$hPǸhWh jF$$hPǸ{hZh jv$PhPǸAh]h jh]h v$Fp8PǸtPEPVÃ+VTtWPEPTtt W uEڃЍe[^_UWVS u]ECx{tC8uttxt @x(uatdž(EmSu VJt5uNSVtSV2ECxt}utSVEEe[^_UWVS}5U BHBt9J ~xAt9K  EpN] MMEECu"hh j8x.x$;t4hh u싇@$4M @0itvi0t8fFssk*t>hh u싇@$4M  hh u싇@$4M!hh u@4S$ hh u싇@$4M!hh u@4S$ [hh u싇@$4M!hh u@4S$ hh u싇@$4M!hh u@4S$ Cx8tR@8xuF8tAxu6xt0hh s$Cp8PVuRhh u싇@$4M !hh $hh u@4Shh u@ 4ƒ {tC@CN[e[^_UWVS ] E({t{CxSBM;P qƉXC@FMBF@4H9FttR9Btzu9t9Bt hVt2~tFx uRtzt Bx tt ztRV ~tFxtVRu.ǃ VufSu s(C(e[^_UWVS}jà jPj2t SEƒx ~cB{tG{uAu!h"h $CiF=>fF6>tF/>kF(>sF!hSh $@C;]R7utGe[^_UWVS u;7hth jjdlj4$PWh W jjEu PE u PhPEh Pu<$ƃAhh VW8#th WSW<$ƃ uÃu uhh uhh jWPà t W؍e[^_UWVS ]u; Vjuu SKǃ 5EPWt W SÃtR uPhl jEPh uuS$Vue[^_ @ @ @ @SPREAD_MAGICtabledefsubs.c %sFIND %s %sTable -active -a = totoCLASS %sreturning existing resultsTable -a = NULLsyntax error in Tag field :%s __toto__ 1 now ; /%\User stack underflow%d%g"%s"Error 1 in scQuery, sorryConfusion 1 in scLoopRight#%s %sPrecomputespreadCreateFromFile() - received NULL filenameuSpreadDestroy received corrupt spread->magicFirst define at least one columnColumn 1 should be type ObjectFirst choose the class of column 1First fix the syntax error in column 1's conditionTableCalculation, F4 to interrupt...spreadFilterKeySet() called with empty spread->colonnesYou should modify colonne %d, which is derived from the colonne you just destroyedFrom field %d of column %d is wrongColumn %d is computed from column %d which is not a list of objectsGive a value to %% before running in column %d at: %sCannot substitute parameter in column %d at: %sAfter test substitution, I cannot parse condition of col %d : %sLoad precompute from TableResult : "%s" scExport() - unkown table->typeinitSpreadTable() - col->headerBuffer == NULLgetSpreadTableTypes() - invalid col->typeStore precompute in TableResult : "%s" 7nnnnnnnnnnnnnnnnnnnnnn7J]nJnnJn7nn7nnnnn7 Gt***t********** !!!!!!!!!!!!!!!!!!!!!!I !!i!!!F!! !! !!!!!!$""(##T$^%D&D&D&D&D&D&D&D&D&D&D&D&D&D&D&D&D&D&D&D&D&D&+%f%%D&%D&D&f%D&5%D&D&5%D&D&D&D&D&&GCC: (GNU) 3.4.3 (csl-sol210-3_4-branch+sol_rpath).symtab.strtab.shstrtab.rel.text.rel.data.bss.rodata.str1.1.rodata.str1.4.rel.rodata.comment40 L ) 1 % ^ /1421C22V\6R ^@ ^8409g;P ' Em&">(V.n4=E{~R0h>_,IR+XEI%.c n&jr.$:&E'N- bjqy [?%3XI_m _ 0;#|K$ait31N]gpx c S  h 16DP\dm *6=FQ\is)3=GPYbtabledefsubs.c_unameunamestatlstatfstatmknodbitFieldscStackspreadCreatestorePrecomputedTablespreadDestroyConditionsinitSpreadTablescAllocscLoopRightscFreesortSpreadTablespreadDestroyColisParamInStringgetPrecomputationNamefreeScStacknScUsednScAllocblocSize.0s.1scMatchscQueryscConditionscLoopDownscExportgetSpreadTableTypes_nuname_xstat_lxstat_fxstat_xmknodexternalTableMakerSPREAD_MAGICspreadCreateFromFileuMessSetErrorOriginuMessCrashaceInCreateFromFilespreadReadDefstrnew_dbgaceInGetURLuSpreadDestroyuAceInDestroyspreadCreateFromAceInspreadCreateFromStackstackText_dbgaceInCreateFromTextspreadCreateFromObjgetDefinitionFromObjuStackDestroysessionGainWriteAccessuTableDestroyuSpreadDestroyColonnesuMessFreespreadGetTitlespreadGetFlipInfouArrayCreate_dbguArray_dbgspreadGetWidthsspreadGetMasterKeysetmessoutFREE_LOWERmessprintfcondCheckSyntaxnamequeryParametrizedkeySetAlphaHeapuArrayDestroy_dbgspreadCalculateOverKeySetexternalServerspreadCheckConditionsstackHandleCreate_dbgaceOutCreateToStackspreadDumpColonneDefinitionsuAceOutDestroystackMarkpushTextcatTextstackReCreate_dbgmessStatusspreadFilterKeySetspreadColInitspreadColSetPresencespreadColSetExtendspreadColSetHiddenmemsetspreadRemoveColonnememcpyspreadCalculateOverWholeClassputscondConstructfreesettextfreespecialfreeposfreecardspreadGetPrecomputation_VTableResultlexword2keytableHandleGethalloc_dbgcondDestroytableSorttableMakeUniquestackExtend_dbgbsDoDestroyinvokeDebuggertimeShowstackClearfreeprotectqueryFind21bsGotobsCreatebIndexFindqueryFind3bsGetKeyTags_VComment_VUserSessionbsGetDatabsMarkbsParentKeylexIsInClassqueryFind31messIsInterruptCalledtableMaxtableSetStringmesserrortableHandleCreatetableSetColumnName_VTableaceInSpecialaceInCardaceInWordlexaddkeybsUpdatebsAddKeybsDoSavetableStore ''5(M)e*+ /012 3 4365G6s4 32 35 9':32D L3j5{6< 9:2 3'5:6J=o-~ /0>?@&=JAnAA D E5 GDg nEHIH H* /J8KGLH^ pLy ~JMN OQ:RT ]SjT~UVW= X 9Y 9,=A INZS Z X?[ R'  0 E   D1  6 /= B 0k  p Jy K  L  J M  M  OO  U Ou  E ^ _ `" a8 aq  E  E c   E7 < H  e R Q  S TU VW'=< BXL T9^Yh o9y,=GP OOTHH Z X 9 #9,f@ J9S XHLfL Hf $H_dHH SXW X3; AYN TYa gY} 9 9g hWiXj 9 K '938HH=_=lmAn LHG? o- D=+=apop o"q*r:APYcm{ S o s$*16E_ d/k p0tA s%/9@u  J3  J3 v' ,J53M \ j9s3 ZWXW Xw #s+5EZ `eYm| / 0LxY Y) /4YD JOYp{ JY JYv JY 9x!Y1L9xCHYPj sx9 9g hWiXj 9 K" ).9=yXA / 0z" '/. 30H{lzz|}{~ ~# + Y ~   ~ ~   !~ !(!O!r!!!!W!X"$$'%B%l% y% ~%J%3% % %J%3% %v% %J%3& & +&94&3&&A&t&''w'( %(ES( g(Es(( (E() #)E-);) O)Ef) z)E)) )E) )E)) )E* (*E2*@* T*E* *9** *E** */+ +0+ ,+E;+ O+E , %,,t,-AV- [-/b-g-0-- -og. l./s.x.0.. .S.L.X. .Y / / / #/J,/:7/ =/H/P/Wa/ h/9x/ ~/Y/Y/W//6/ / /9/3/=#0:0^0lh0x0A00L00H0 0000   $(,048<@DHLPTX\`dhlptx|  $(,048<@DHLPTX\`dhlptx|  $(,048<@DHLPTX\`dhlptx|tabledefio.o/ 1133374751 530 202 100644 17228 ` ELFl$4( UuUuU u ujU u ujU u ujUuu ujUVSu] hS$ PhS$ PhSh4ShShShS$t\$xuM8tHzu=zt7jPPhS $uـ~tFPhS~DtFDPhSthSthSSh`Se[^UWVS }uhhu Ã9pt#php\Ge[^_UVSu] hhS@@5 RSVe[^UWVS }uhhu Ã9p t#p hp hGe[^_UVSu] hhS@ @5 RSVe[^UWVS }uhhu Ã9pt#phpXGe[^_UVSu] hhS@@5 RSVe[^UWVS }E @ E9U B{FPhW{<tC}4jE0uEPuEUB4}jM1uEPuEUB4} uÃ8hhjMq,UB,}t SÃSMq,hhjEp,Ul } u8h hjPǃ}jjPÃEPS$$h hj PSPƃS hhVExP<t& VhhPExP6 W%} uÃ8}t PÃj;SE ^#4$g&  ,P& >&V,n2`8;%Pp_Ss }  8!>\S^klE\ ER\E [ !+2<EOW]bgp~g 1 $2FPZhv:#6Etabledefio.c_unameunamestatlstatfstatmknodshowOptsconvertCondBufferOutspreadReadMenuconvertCondBufferInout_buf.0_nuname_xstat_lxstat_fxstat_xmknodpresenceChoiceextendChoicehideChoicespreadDumpDefinitionsaceOutPrintgetLogintimeNowtimeShowstackCursorstackNextTextspreadDumpColonneDefinitionsspreadColSetPresenceuArray_dbgfreekey2textspreadColCyclePresencespreadColSetExtendspreadColCycleExtendspreadColSetHiddenspreadColCycleHiddennamespreadSaveDefInObj_VTablebsUpdatebsRemovebsGotobsGetKeyTags_CommentbsAddData_TitlelexaddkeybsAddTagbsPushObjstr2tag_From_Min_MaxbsDoSaveuStackDestroyspreadReadDefuTableDestroyuSpreadDestroyColonnesuArrayCreate_dbgstackReCreate_dbgmemsetstackHandleCreate_dbgfreeprotectcatTextaceInSpecialaceInPosaceInKeyfreeunprotectaceInCreateFromTextaceInCardaceInWorduAceInDestroystackText_dbgpushTextaceInIntspreadColInit_VClasslexword2keystrnew_dbgaceInUnprotectQuoteuMessFreestrncpyuMessSetErrorOriginuMessCrashgetDefinitionFromObjaceOutCreateToStackdumpKeyBeautifullyuAceOutDestroyhalloc_dbg 5Me        I!W ]n"    # % 3%HP&} %$ %& *%9D(g u%& %*4 :O Uc iqy& &  ,  , * 0AI&R Xfn&w }     '.6/S0a1n2!34"54 6 71 66T4e j64 648  94* /6D:J4^4o t6477 64  6 7)  . 6: 7M  R 6^ 7u  z 6 4   6 , 4  6 ,& 4<  A 6M 7c  h 6t 7  6 7  6 7  6 7   6 7  % 61 7D  I 6U 7x   6 , 4  6 7  6 7   6$ 77  < 6H 7[  ` 6l 7  ; 7 < 7  6 7  6 7   6 7 1; =Q > @ A  B  C>DH TElFxG  E HI G G(4JTIyK L HM GFFGNONM8 BPS ]PfLxHJIQR3 B%\SJ& RB$f$$**=IbKpT}U(R(.R\I| CKQ PI V4LCHKMSI] iWrV}OXXIK)Y<IaKxYRIKY Z [NM$O8>L>. E]^_ P #E5 R ZGf  GG>1=BXKY q`v    $ , 4 < D L d l t |                    $ , 4 < D L T \ d l t |                     $(,048<@DHLPTX\`dhlptx|  $(,048<@DHLPTX\`dhlptx|  $(,048<@DHLPTX\`dhlptx|flag.o/ 1133374752 530 202 100644 4048 ` ELF4( UuUuU u ujU u ujU u ujUuu ujUWVS E=7j3hj$$6hjjjE }w AvME})DŽDŽ@~EE} DŽ@ ~E<E}w@jChS E@PhPPh E}vt SEPu5 j E}IMjMhu5U Sƿ8u\ S uuPu: SU|#u$jSUDPuC j9i}tPUe[^_UWVS u E;t PE=tujmh$EPV5t.E PPh>>t(>|t<tC;t;|u;tEPV5tRjEPVuh2P}v&hh Vuh E < t|s{Be[^_UWVS u} hhh5 F< t< A;vh<QSVP5 C V9hhj5 e[^_Uuu Pflag.cbit%dDefaultFlagbad arguments to flag()Flag%s#%s|Bad character %c (0x%x) in flagflag set %s has overflowed, with %sGCC: (GNU) 3.4.3 (csl-sol210-3_4-branch+sol_rpath).symtab.strtab.shstrtab.rel.text.data.bss.rodata.str1.1.rodata.str1.4.comment4T @  %+ 02>?2DN$4XWh0   &> V&n,7@ JQ[b fnu}vy ,7@JTxew5flag.c_unameunamestatlstatfstatmknodmasterDictdictListflagValuecharOKlastSet.0dict.1s.2_nuname_xstat_lxstat_fxstat_xmknodflagSetDicthandleHandleCreate_dbgdictCreateuArrayCreate_dbgmessprintfstrnew_dbgflaguMessFreedictAdduArray_dbgnamestrncmplexMaxuMessSetErrorOriginuMessCrashdictFindmesserrorlexaddkeyflagNameFromDictstackReCreate_dbgcatTextdictNamedictMaxstackText_dbgflagName 5Me  #Yx    !"  ).#I$P n$%$$"& %-6G L'S X(in)*" +3 8'DI(V - ./.0 !&1?K,aql.o/ 1133374752 530 202 100644 6044 ` ELFp 4( UuUuU u ujU u ujU u ujUuu ujUWVS u]EjBhjjV%n+3:BJR0\g~'/29DMYdis}>&~( Q  aql.c_unameunamestatlstatfstatmknod_nuname_xstat_lxstat_fxstat_xmknodaqlCreatehalloc_dbghandleHandleCreate_dbgaceOutCreateToStderraqlQueryCreatesetjmpaqlNodeOutaceOutPrintuMessFreeaqlParseaqlScopeCreatedictAddaqlErroruArray_dbguMessSetErrorOriginuMessCrashaqlCheck1aqlExecutestrdupstrcasecmpdictFindstrncasecmpstrnew_dbgfreetableCopyaqlCheck2aqlQueryOutaqlEvalaqlDestroyaqlTableaqlIsErroraqlGetErrorReportaqlQuickaceOutCreateToStdouttableOutuTableDestroyuAceOutDestroyaqlGetErrorNumberaqlGetErrorMessage 5Me   , 6E_ px    ; Jl|      % *!1 6"Z#n v  %5 :!A F"` f&' ! "' !  "6 <(^ d& ( & & ) ! "#*C+   0,D LX jr }-.+@T$_1s2| /40567aqlparse.o/ 1133374753 530 202 100644 42688 ` ELF0e4( UuUuU u ujU u ujU u ujUuu ujUELh8hp0`dUSuÃuh dHPh5L؋]d`B` d`P`T$PUWmPHJ$MUƁjqh!Lphd+pd+ d+ d+d+d+~d+dj}h!Lph,d+'d+ d+d+d+d+d+%d+qd+ Wd+!=d+"#d+# d+$d+$d+d+d+d+md+Sd+ /d+  d+ d+ d+ d+ {d+ Wd+|3d+|d+|!d+|"d+| d+|#d+|[$d+ 7%d+ %d+ d+ d+ d+xhh!Lphd+dCd+`#d+ d+d+d+x d+x d+xid+xE d+x! d+xhh2hd+hhh5hd+lhh!Lphd+tXh=dtdHPh5LPh85}Uu=dtdHPh5LUWVS EE=tEE=== u 7u}uG!8]EȈ }v$hh 5$E4N;5@9zF@=~<U:U'hh 5$ )4J;5wr@9uaF@=%~<E8E=hh 5$4r;5ws@9ubF@=~<U:Uhh 5$t7AMUPm}ÁEHEU:@8tDmUPJUPUpt }wUEأƀUPm}!=uYMUPfMUPOMUP8~88y55H@Ee[^_ËT$L$t Ã:t9t:uU}UM8y5Q P @UEPJUWVSE=5 9!)׉}}U+U< uy SE$Ã}tLtHP5u P5SRQDS5S5=tu;= hMl =M<UE7EM ig~u=yy xLD@;u.ރ=< 1ug=yy $=$u95(t :u9ru:x ;uZy F})ttx ha;=rA @w<m;=sθ=u JEEu\U)‰UR@)Nj7F4@4@)EMQ@)Nj7F4@t4@5=U=f$xLMBUMQzt RzuMBLABhhLpj@@40MPQPP<LhhLpj@@40MPQPP<UhhLpj@@40MP P<hhLpj@@40MPQP P<chhLpj@@40MPP< hhLpj@@40MPP<hhLpj@@40MQP@P<hhLpj@@40MQPPP<IhhLpj@@40MQPP P<hhLpj@@40@MQPP P<hhLpj@@40@MQPP P<[hhLpj@@40@MQPP P< UBhhLpj@@40MP`P<UEH yt IyuUAhhLpj@ @40MPHP<>hhLpj@ã @40hhLpE0$CHC< hhLpj@@40MPHP<hhLpj@ã @40UBChhLpj@C MPHC< %hhLpj@ã@40UBChhLpj@C MPHC< UEH yt IyuUA}hhLpj@ @40MPChhLpj@ @40MQPPP<UEH yt IyuUAM@nUB@nMP E@BxUBыRPP [EPBEUBыRPP (EPBUBыRPP hhLpj@ @40MPRMY{t [{uhhLpj@C@40UCHC<MY{t [{uhhLpj@C@40UCHC<MY{t [{uhhLpj@C@40UCC<'MY{t [{uhhLpj@C@40UCC<hhLpj@@40@nãxt [{uhhLpj@C@40MCdC<ChhLpj@@40@nãxt [{uhhLpj@C@40UCpC<hhLpj@@40@nãxt [{uhhLpj@C@40MChC<5hhLpj@@40@nãxt [{uhhLpj@C@40UBCdC<hhLpj@@40@nãxt [{uhhLpj@C@40MACpC<%hhLpj@@40@nãxt [{uhhLpj@C@40UBChC<hhLpj@@40@nãxt [{uhhLpj@C@40MCdC<hhLpj@@40@nãxt [{uhhLpj@C@40UChC<hhLpj@@40@nãxt [{uhhLpj@C@40MCC<hhLpj@@40@nãxt [{uhhLpj@C@40UCC<hhLpj@@40MQPPHP<8hhLpj@@40MQPPHP<UhhLpj@&@40MPP<hhLpj@(@40MP0hP<ZhhLpj@)@40MP0lP<hhLpj@'@40MP0pP<UhhLpj@@40MQPPP<|hhLpj@@40MQPQPPHP<-hhLpj@@40MQPQPPHP<h hLpj@ @40MQPQPQP P<h hLpj@ @40MQPQPP<Dh hLpj@ @40@MQPP  P<h hLpj@ @40@MQPP P<h hLpj@ @40@MQPP P<ThhLpj@ @40@MQPP P<hhLpj@ @40@MPP<hhLpj@ @40@%MQPP P<jhhLpj@,@40@0P<(hhLpj@,@40@0P<hhLpj@!@40MPP<hhLpj@"@40MPP<`hhLpj@!@40MQPP<hhLpj@"@40MQPP<hhLpj@#@40MQPQPP xP<hhLpj@$@40MPP<FhhLpj@%@40@MQPP P<hhLpj@%@40@MQPP P<hhLpj@%@40@MQPP P<VUBFhhLpj@ã*@40$sC0C<h hLpj@ã*@40$wC0C<h!hLpj@ã*@40M1C0tC<de[^_GFGFGG0G0G0G:G0G5G4G6G/GG/G/G/G/G/G/G/G/G/G/G/G/G/G/G/G/G/G/G72?>:3189////////////////////////////////////=;)///,/(///////////////&/%/+/// //////'////////<///-/////////$/.///////////////E/"/////#////////// /////// ////*// ///////// //!///D///////// /CBA@        'W   $ ( 0 .1 /  333] 3] %'E7a#V''F D!"#9?CJ R% "U!"#%% ) ) ) ) ) ) ) ) ) )4:PK;Q@4^5_6`5 *6&A%8b7GL8!S%B!TMH%%%%%I%<N%:c=;d *%=f>g +% , , , , , , , , , ,2222222222?h -'@jAkBl?i22222222222222222222222222 -CmDnEo2Fp22222222222222222222222222*XGq*XHrKw*Y*Y*Y*Y*Y*Y*Y*Y*Y*Y++++++++++++++++++++IsJuLxN{JvO|P}-[Q~-[It+Z-\-\-\-\-\-\-\-\-\-\MyRSTUVW'cdMzXYXYXYXYXYXYXYXYXYXYZ+ZZefZZZZZZZZZZ[\[\[\[\[\[\[\[\[\[\]]]]]]]]]]ghijklmnoprstwxyz{}~²óĶŸƹǹǺȼɽʾ˿  0 (0<HDT` lxX2~l.8(4h@<LXDdp|TTx 8:jz $,4<DL&T*\.hBp`xxT` ~D  ,8DPX`hNpRx8:<JB^BbfFJjl ppT$,|8v@dHnPbX`dl0t| (08DLX`hpBx  ,4@XHP\hpxn  . ( 4(<DP0\dp|Vr    "$$$$$+$+$$0123446669$$$AAAAEAAAAAAAAAAAAAAAAAAAAA$$$AAAAEAAAAAAAAAAAAAAAAAAAAA$ aqlparse.yBad date/time literalaqlparse.lclass%d%fbad switch yylook %dyacc stack overflowsyntax error_DEFnowtodaysyntax error: invalid characterInput string too long, limit %d Vm*D^7Qk!;Uo#GkCg?5Y}- - - - - - j  w$K76)v1 Fg2DB(CtE9.u $f)FDB(C'E.O$x)yNFdeiDB(C'EP..$=<)acjbFM lDB(C'Em.O^`$_)hNF:DB(C'Er.F.]D$SFRE)DBFCMEVXk('F/.0DBCE345$pqs)F'DB(CE.>-;n G%!"A&'+,8U-#HIJ G%!"A&+,>-#HIJL G%!"A&+,U-#HIJ G%!" &+,-# HL G%!"&+,OU-#GNHIJ %!"&F+,DBCE#-FMDBCE G%!"&+,)YW#))(HIJ.((?..*'@''TQZ[\o@@z{|}~\\@@LGGHIJUUUHIJ%&%%&&ig4][igXigWigigigig\zxwigigw9u}gMMigigigOAigig=igigwkig MEwwwwwwwwww^8+ igNwwigig|fMwigigig&%igigigigIigignig)kigkw> h`ttig|GGigigigigigigigigC}(IOigligigigigig=igigw-"igigigigigwigigigwigigigwwigig igigpec                ig@$ (;"#$$  -%([:.@  , +-*/% ![:.(((((:):,:)]]],..]]],))),  )) .GIJKLXYdef   .()HMV.Z[_;<=ABCD  &*,RSTUW^`ab0126789:c>?@EF!$"345NOQ\]'+-%#P/+2M\-< N0 0sRw1@h~6v-_v2 J!!"a""o##~$%%&&#'''<(K((()W)f)))M***7+++',q,,-E---.S...5////00{0GCC: (GNU) 3.4.3 (csl-sol210-3_4-branch+sol_rpath).symtab.strtab.shstrtab.rel.text.rel.data.bss.rodata.str1.1.rodata.str1.4.rel.rodata.comment40 o ) 1p %  /Ih 42I}C2 JAVJ R @ ^d4dg`g  Pm &>$V*n0;LA`KdR>gms`z$@  <@  X X=!  !'7-4 ;BIPX S_ 3g ozw` ~LP`Idh l M2 8"*08BIPW_ep~aqlparse.c_unameunamestatlstatfstatmknodyymaxdepthaql_LlexStringlexPostimeCreateFromStringinputunputtokPosyyexcayyactyypactyypgoyyr1yyr2yychkyydef_nuname_xstat_lxstat_fxstat_xmknodyysyy_yysyyvyy_yyvaqlParsestrnew_dbgyyparsetimeParseaqlErroryyin__iobyyoutyylexyywrapyytextyylvalyylengsscanffprintfyylookyyerroryyvstopyycrankyysvecyytopyybginyymatchyyextrayylinenoyysptryysbufyypreviousyymorfgyylstateyyestateexityyfndyyolspyybackyylsp__flsbufyyinputyyoutputyyunputyypvyypsyystateyytmpyynerrsyyerrflagyycharmallocmemcpyreallocyyvalhalloc_dbgaqlOpTypeNameyytcharyydebug 5 M!e"# )*+ , "+RW1n22 2)344444+146EK4Pa fp u)z344444 4$4)8>4CRX4]lr4w444444"(4-<B4GV\4aq3z43434343 4%3.449I3RX4]m3v|43434343 4!3*045E3NT4Yi3rx4}34343434 3&,41E JT2Y)^3ci4n24444343"4'73@F4K[3dj4o34343 2543   2 5  4 3  8 B 2G )L 3Q W 4\ k v ~   ,  / 6 7    , 2 D D% 4* 24 E: =@ FF CT :m : 2  / 6 G : < ; ; ; ; E2 8 /= 6I GO :Z :h <w ; ; ; ; E  / 6 G > < ; ; ;& ;7 EJ P /U 6a Gp : E 2 H I ? H J* E7 C? KH 4N 2T H^ H E 2 A B 2 C//CL'/0C<2//L/&P$QRSTU#V,P5Q;RDJ$g&WW$X$&X&$Y $&Y &)$;E J8]b$m&ZV0VVVVV3ZUUV$0)V3V<BKjVU 8TU$$ V3VBSOiZpyZR QPS'S.3DZSZdZ [ZZ [ZZ3ZB GS[XZp [Z [Z "['Z?T Ye[jZ [Z [ZZ!6 ;G[LZq [Z [Z'Z6 ;G[LZdyZZ [Z [ Z $3\;)CX ]i[nZ [Z [  [$ZA FR[h}ZZ [Z [Z"7ZHZp uZ ZZZZZZ-Z< AM[RZ| [Z [Z [% *6[=ZQ Vb[{ [ [Z [3 8D[KZ_ dp[ [ [Z ,[1ZPgZ [Z [ !Z: ?K[g~Z [Z  [# : ZS  X d [  Z   [  Z! !![;!R!Zk! p!|![!!Z! !![! "Z%" *"6"[R"g" l"x"[" "Z" ""["" ""[# #Z3# 8#D#[`#u# z##[# #Z# ##[## $ $[$ %$ZA$ F$R$[o$$ $$[$ $Z$ $$[$ % %%[.% 5%ZQ% V%b%[%% %%[% %Z% %%[&& &,&[=& D&Z`& e&q&[&& &&[& &Z& &&[')' .':'[K' R'Zn' s''['' ''['Z'' ' ([(Z-(B(ZQ( V(b([g(Z(( (([(Z(( (([(Z)) )+)[0)ZH)])Zl) q)})[)Z)) ))[)Z)* **[*Z>*S* X*d*[i*Z** **[*Z** **[+Z(+=+ B+N+[S+Zx++ ++[+Z++ ++[+Z,-, 2,>,[C,Zb,w, |,,[,Z,, ,,[,Z, - --[-Z6-K- P-\-[a-Zy-- --[-Z-- --[-Z.. .&.[+.ZD.Y. ^.j.[o.Z.. ..[.Z.. ..[/Z&/;/ @/L/[Q/Zv// //[/Z//Z/ //[0Z0 0+!060 ;0G0[N0Z_0 d0+l00 00[0Z0%' ..l :x :| ; : 9 : 9 : ; 9 : 9 : 9 : 9 : 9 : 9 : 9 : 9 : 9 : 9 : 9 :( 9, :4 98 :< ;@ 9D :H ;L 9P :T ;X 9\ :` ;d 9h :l ;p 9t :x ;| 9 : ; 9 : ; 9 : ; 9 : ; 9 : ; 9 : ; 9 : ; 9 : ; 9 : ; 9 : ; 9 : ;9:; 9:9: ;(:094:8;@:H9L:P;T9X:d:l9p:t;x9|::9:9:9:9:;9::;9:;9:;9:;9:;9 :;9:; 9$:(;,90:4;89<:@;D9H:L;P9T:X;\9`:d;h9l:p;t9x:|;9:;9:;9:;9:;9:;9:;9:;9:;9:;9:;9:;9: ;9:;9 :$;(9,:0;498:<;@9D:H;L9P:T;X9\:`;d9h:l;p9t:x;|9::;9:::;9::;9:;9:;9:;9:;9:; 9:;9: ;$9(:,;094:8;<9@:D;H9L:P;T9X:\;`9d:h;l9p:t;x9|:;9:;9:;9:;9:;9:;9:;9:;9:;9:;9:;9:;9 :;9:; 9$:(;,90:4;89<:@;D9H:L;P9T:X;\9`:d;h9l:p;t9x:|;9:;9::;9::;9:;9:;9:;9:;9:;9:;9: ;9:;9 :$;(9,:0;498:<;@9D:H;L9P:T;X9\:`;d9h:l;p9t:x;|9:;9:;9:;9:;9:;9:;9:;9:;9:;9:;9:;9: 9:;9: ;$9(:,;094:8;<9@:D;H9L:P;T9X:\;`9d:h;l9p:t;x9|:;9:;9:;9:;9:;9:;9:;9:;9:;9:;9:;9:;9 ::; 9$:(;,90:4;89<:@;D9H:L;P9T:X;\9`:d;h9l:p;t9x:|;9:;9:;9:;9:;9::;9:;9:;9:;9:;9:;9: ;9:;9 :$;(9,:498:<;@9D:H;L9P:T;X9\:`;d9h:l;p9t:x;|9::;9:;9:;9::;9:9:::9:::9:(:4:<9L:P;hB  $(,048<@DHLPTX\`dhlptx|  x|  $(,048<@DHLPTX\`dhlptx| aqlcheck.o/ 1133374754 530 202 100644 16996 ` ELF,4( UuUuU u ujU u ujU u ujUuu ujUVShhu jƃ hhjFhhvuà 8tj; t; t; t; t ; tC;uI;tDC;t<; t; t; t ; t; uC;u;t @SP;ue[^UVSuhhVj ÃVj  jh 3$hVjj C ؍e[^UVSuu!hh$>u!hh$(~@@ p $jhQVp hhpj,F$hPF$@F$F$@F$@^$hhjj@C^$ hhjj@C^$hhjj@Cjh hVpsCV$@B V$@ B$^$pC(F$P(@B$hhVpjjhVpjhhVpjhlhVp ~$t v$F$e[^US]{t sC{t sC{t sC]UhOhu j@U@40UWVS }?wG E> u7U pj ÃU pjCVP_ a>u\U pj gEU pjRÃU pj>UZVSC@UE?"GxX{t [{u;u-{u'GX{tCxt[{t Cxu;t;u;!{tC8t?U pjSPC@hTw O$AP;PsG$@@1hHhjG$pW$BHG$@@O$AP;PsAG$@@2hIhjG$pW$BHBG$@@O$AP;PsAG$@@2hJhjG$pW$BHBG$@@W$FG$@G$@G$xt.@9p t9pu!W$BW$B BG$@ wG$pG$@G$8uh>vtcPVjÃpjY‹FCF>uFB FBFBVCF>G$xt@9pu ~ ]CSh hWvSh hWv WhuVj :Ãpj‰CFBF B FF CFv>t>t>t>t >G$x @@@;|t" 6 PhpÃ~\hw jjVw hw $hj5w hw WSVj Ãpjz‰CG$@@@BB@G$@PCBG$@@pG$xt@@;toG$8uhvt jhbu6E p C C pG;CruSU B$p FP<tnx tdMy$t[WA$;B$uPRU؃}utf>}t8UM;u,}tqut7}t UE9Pt&C 69kvVG$x(M y~rPhnq h(E p $huWU r hXM q $huuE p G$UB$hhuM A$@ pMQ$hhU pjt >t>u4~~ 9Fp vhF<@Phu K> t>t >E[ {u {{t"{t C€8_uT sƒBC8_t6C$x t-@ xt$@x$t@$@ xt@xt@PtGRvu4GF> u>u >uE [G(}uC vhF<@Phu !hh$e[^_US]U ;wu$C t@BuzRC$p fRsU{4Tt!hh$<C0@&hh$]øUWVS }?$_ tu wS:[uG4Tu wƃu w 9t& w$hw{t0C8_uhVw0sVw0[FuG4T}t ue[^_UWVS ]u}t Wu Sփuq{t GPuVu s { t GPuVu s {t GPuVu s }tWu SUe[^_US]tH{tCX P{ tC X P{tCX P]aqlcheck.c__JUNKcurrNode _%s_%dpreDecls enteredpreDeclsinvalid declarationlocal_field_namelocal_table_fieldobjecttransferparenttransfer_%sMaking transferparent for: with parent: parentillegal outside declarationtransferdeclpreDecls exitedUser stack underflow_DEFlocandumnaming_outer_nodenaming_inner_nodereference_nodedecl %d: stackeddeclFound existing loc %lx existinglocinNodenewlylocated%ddefault iteratorvariable %sscalar variable %s undefinedtable variable %s undefinedfield number %d out of rangefield name %s not in tableaqlCheck1() - called with NULL pointeraqlCheck1() - called with NULL aql->queryIllegal argument to boolean clause `exists_tag' (tags-by-name only)makeNewHookedDecl() - type has to be FROM_LOC or FROM_TABLEmake artificial FROM_clause declaration, Label %s No %d - only one declaration allowed for default iteratormultiple declaration of variable %s in same scopeLooking in scopes for locator matching name "%s" to suit node: The name from the inner node is "%s" and the name from the outer node is "%s" and the reference name is "%s" Assigning the locator already defined at node: To be also the locator of node: Did not find existing loc, making new one at %lx for node: preLocCheck() - inNode->left == NULL in FROM_LOC-nodepreLocCheck() - a LOC_xxx node has inNode->loc == NULLMalformed FROM in SelectFromWhereCannot dereference a row-based variable directly Declare a column-variable which can then be dereferenced : Use something like %s:1->%s instead!%s is row based and must specify the column that is to be extracted from the iterating rows : Use something like %s:1 to refer to the first column in the row-variable %sno unnamed iterator declarationiterator variable %s undeclaredcheckField() - can only check fields against a TABLE_SFW-type nodecheckField() - invalid type of fieldNodenumberOfTableColumns() - TABLE_OP node not yet initialised with correct vtype 'T'numberOfTableColumns() - unknown tableNode typetable %s operator - column number mismatchpostTableTypeCheck() - tableFunc must only operate on a 'safe_table'table-argument for tableFunc expression must generate ONLY 1 columnpostTableProcess()->case nLOC_VAR: locatorDefinitionNode is NULL, inNode can't be a LOC_VAR, if it is defined - see aqlError No 992postTableProcess()->case nLOC_VAR: TABLE_VAR->definition is NULL, can't get here if table-var variable is defined - see aqlError No 991postTableProcess() - impossible query, %d select-fields in TABLE_SFW-node]((;; ;|||||||||||||||||||||||dddGCC: (GNU) 3.4.3 (csl-sol210-3_4-branch+sol_rpath).symtab.strtab.shstrtab.rel.text.data.bss.rodata.str1.1.rodata.str1.4.rel.rodata.comment4  <6 % + 02 8?2"R*<N ?x Z ,4@,c.  ,3 &>$V*n01 X>QfO`` QjsR}l;)(1f %-5=LWnyO_-6BMXgwaqlcheck.c_unameunamestatlstatfstatmknodaqlSetParentspreProcessLocPoscheckEnvFinalisepostDeclspreDeclspostScopepreScopepreLocCheckpostTableProcesspreTableProcessmakeNewNodemakeNewHookedDeclparent.0aqlCopyNodecheckFieldnumberOfTableColumnsaqlNeedsSorting_nuname_xstat_lxstat_fxstat_xmknodaqlQueryCreatehalloc_dbghandleHandleCreate_dbgstrnew_dbgstrcpyaqlScopeCreatedictHandleCreatedictAdduArrayCreate_dbgaqlCheck1uMessSetErrorOriginuMessCrashaqlTraverseblockSetFinalisestackHandleCreate_dbguMessFreeuStackDestroyaqlErroraceOutPrintaqlNodeOutmessprintfaqlCheckEnvOutstackExtend_dbgaqlNodeTypeNamehprintfaqlNodeOutPrettystackMarkstackCursorstrcasecmpdictMaxuArray_dbgdictFindaqlOpTypeNametableHandleCreatetableSetColumnName   5!M"e#$ & ' (:)] e&r+~ , - / 0 / 0.91F R&]c2 3 3 31*(*EJU1al1v{1145555 ?& 614 / 0 7 #8+ 37  9( 8 :@ M; ; ;  6   C H Q 1Z _ h 1q     <  ) =<  D 7Q >Y  a 7m  u } 8  7     ( 61  T e p y    8  /   0?  D /K  P 0  /  0$w,  6 6 7 ,86 G8Q `8j {8 7? 7 8-@AB 7' 27> M8U `7l }8 C & C, 47@ Q8vD* &, C5DL*w &, CD_ n&, C*S _&o |( / 0B G/N S0h v6 9 7 = P6i |  9 6 6! 36[ x 6 6 6 / 0C U6EAp 6 / 0 /' ,0D I/P U0E 6 &=FX4 / 0 6/ 4/; @0f k/r w0F' ,/5 :0G R& &+ 3F8 AGUGu411 1  $(,048<@DHLPTX\`dhlptx|  $(,048aqlrun.o/ 1133374755 530 202 100644 45984 ` ELF̃4( UuUuU u ujU u ujU u ujUuu ujUS]jhjSpjh|jSp ]UWVSEhUptjuuS8ljދ[uEx~5uhp uh0Ur uO}u!hh$dEx~hp E?~4Tt!hh$Uz~" v0 PhEp F0e[^_UWVS] Y$jC0Psu sh&s$8F8x uPVhEp hv0~t CPuWvV F, CPuWV/F,F8xt pF8@F88^ 0F8^8Upjd,CPuWvF,F@0F0CPuWv7F,V$F@4BV$F@0BF@4EE@Pv0F@4ff0~bsMs ittuhKhjF0@$0!hKhjF0@0VR0 hLhjF0@$0!hLhjF0@0VR0 hMhjF0@$0!hMhjF0@0VR0 hNhjF0@$0!hNhjF0@0VR0 <Fp0jjv0"hPhjF0@$0 hQh$F$@ 8t!h[h$@V$B @0F0B @4F4B @,F,CSuWv^ESuWv N }Fx0F X0swthvshsPW@shxPW!hh$[_Wv0u*F,!hh$<F4TF,e[^_UWVS u}>t!hh$h~F @X$~(t!hh$;$} {uF~"uWN shw  sCvsCFrvPF~3uWTNSv vPVhw Nvv~2uWNv vPVhLw Ѝe[^_UWVS ]u}{{kthC p E p$hfUr uu> M qhEp $huu Ur ;t;u3u;P;Puuuu u {kthX M qPUB8ph2 hEPMA$U4U!h2 huMAU4V0v0h:PMA8p-h7 hEPUB$M4U!h7 huUBM4V0v0h:PUB8pv0uuuv0MA8phE hEPUB$M4M h2UB8p2hJ h_~4tF4PhpvE.~:uWh` hjMA8pPhw jhd hjUB8pPMA80utb~uWhw UB8x thEx~ZUBB H;EuEB AU9J7MA8@~(uWUB8puhw Ee[^_UWVS|uEx~ jhBuVp H$$V$BF4BF0F,IF4sF,9F4iF,)F4fF,F4tF, F4bF,V$F,uBF4BF0~,uF$@F4F40F0~E@Puu vFx,u F,Fx,u F,mVz4it&z4ft B4PhrFx,u F,Fx,u F,Vz4it&z4ft B4PhTr MN03 ]C<8sh hC0s(Eh hC0s(EF! vhdv v(u+u& v uF,F0F, vt v t^0u& vuF,F0~E@Puu v ǃuF,F0Nu& v PuF,F0#uuF,F0F, vu v t^0E@Puu v ǃuF,F0 vEv uu F,F,}tt tV0Dhv h$!h} h$8} u'~,u!h h$\My~euQ ~,t~,t}~,tKPh]s Vs hs F,e[^_UVSu ]UuE$4SVуSVSVSVуSVуtSVSVуtSV~aZtjSV=SV&h h$Ѝe[^UM UEwC$P9X9N9D9:909&h h$UE EEwr$lE@EuEdE@PA0؃h h$UEM Utt 909&hh$LUVSEU utt"@ RÉ4$9F RÉ4$9&h1h$e[^US]{,u!h@h${,u#{4buC0{,u{4iu {0]UME Utwt tt6)2-љ&h_h$UEE Et$w t tt/+'#huh$<UWVS }u 9}hcw C9|e[^_ @ @ @ @Exec AQL, F4 to interrupt...aqlrun.cUnrecognized tag %sUnrecognized class %s_DEFdefault iteratorvariable %s+%1d-%1dfuzzydefiniteloopVariables (%s): sfwfromeval IS_COLUMN in Loc %lx eval IS_METHOD in Loc %lx nameclasslengthccreate_timeupdate_timecreate_sessionupdate_sessionnode_sessiontimestampnode_timeeval IS_OBJECT in Loc %lx eval IS_FOLLOW_TAG in Loc - FROM_LOC: %sfollow fromexistsmight existdoesn't existeval done : fuzzy eval IS_LOCAL_TAG in Loc %lx eval IS_CLASS in Loc:locname is %s truefalsemulti value on iteration %don loop "from" fieldwith locator assignmentnext CLASS in locend CLASS multi value User stack underfloweval fuzzy eval empty single value: knownnullprocessLoc:evaluating wherestatus is still fuzzytablestreamreport to results-%s: (NULL) %d %g evalExprotherchild_value = %s | **** evalTable failed - table value is NULL **** evalTable succeeded - table value is KNOWN XXX unfuzzy re-run produced fuzzy result XXX **** evalTable isn't sure yet - table value is FUZZY aqlEval() - tableNode not of value type 'T'Returning table of %d entries Unrecognized class %s in construct object("", ...)postAssignTypesAndClasses() - inNode->loc->source != IS_ROW (should have been set by aqlcheck.c:preScope)postAssignTypesAndClasses() - type of FROM_TABLE->left is not a TABLE_VARpostAssignTypesAndClasses() - nLOC_LOCAL_FIELD has to have a IS_ROW loc->sourceInvalid column-selection on %s:%d The %s is not row-based.Invalid column-selection on %s:%s The %s is not row-based.postAssignTypesAndClasses() - invalid type of declaration for %spostAssignTypesAndClasses() - invalid type (%s) of fromLocNode->lefttable combining operator - error in column %d value-type mismatch between the columns the two tables%x->%x not sorting, should output table header here? or a bit later... evalTable() - invalid scalar result value-typeevalTable()->case TABLE_VAR: has to be defined by a TABLE_ASSIGN nodetable combining operator - value-type mismatch between the columns the two tablesevalTable() - invalid operator for TABLE_OP nodeevalTable() - invalid sort spec operatorevalTable() - invalid type of table nodeunknown inLocator value in wakeUpLocalwakeUpLocal() - Should have caught error 902 earlierwakeUpLocal : about to bsCreate(%x) wakeUpLocal : locator %lx created and marked(%s) useObj = %lx (from trueObj of loc=%lx) wakeUpLocal : locator %lx jumped to mark(%s) in useObj = %lx Follow position : Trying to dereference (->) something not an objectwakeUpFollow : about to bsCreate(%x) wakeUpFollow : locator %lx created and marked(%s) trueObj = %lx wakeUpFollow : locator %lx jumped to mark(%s) in trueObj = %lx loopVariables():IS_COLUMN - the ->table value of the locator is NULLloopVariables():IS_COLUMN - type %c not supported for loc->typeinvalid valuetype of operand for method 'name' (operands can only be object- or tag-values)invalid valuetype of operand for method 'class' (operands can only be object-values)invalid valuetype of operand for method 'length' (The object-value does not belong to an A-class)invalid valuetype of operand for method 'length' (operands can only be Text-values or A-class objects)invalid valuetype of operand for method '%s' (operands can only be object-values)invalid valuetype of operand for method '%s' (operands can only be references to object-nodes)syntax error : unrecognised Method-name '%s'invalid value-type of left expression in object constructorleft expr value=%s (key=%x) invalid value-type of right expression in object constructorright expr value=%s (key=%x) eval done loc_value=%s (key=%x) Follow tag : Trying to dereference (->) something not an objectfollowtag looking for tag %x ("%s") in object %x ("%s") -> (%s) eval done by follow: tag absent IS_FOLLOW_TAG opening object: definition_locator %lx created trueObj %lx ("%s") eval done opening object: from_locator %lx got useObj = %lx and marked(%s) eval done : from_locator %lx zeroes useObj loopVariables() - bIndexFind() returned a value other than 0,1,2Positioning by name within an object has to follow a tagloc=%lx - moved to tag %s in useObj = %lx and marked(%s) eval IS_ROW in Loc %lx (column %d) zero row-counter for column %d eval IS_(LOCAL/FOLLOW)_POS in Loc %lx Positioning within an object has to follow a taglocal/follow_pos waking up local fromFieldNode->loc->key is %s(%x) loc = %lx - pushed existing mark(%s) in useObj eval done : from_locator %lx gets value from useObj = %lx and marked(%s) loopVariables() - invalid fromFieldNode->loc->source %sAbout to iterate over values for %x, set up something to accept the results, am_sorting=%s next ROW in loc=%lx column %d - current at row %d end ROW multi value in column %d next POS in loc=%lx - jumped to mark(%s) useObj = %lx end (LOCAL/FOLLOW)_POS multi value loc=%lx - popped markStack useObj = %lx and jumped to mark(%s) loc=%lx - moved down useObj = %lx and marked(%s) loopVariables() : should not loop on source type %dloopVariables() - processThisLoc produced FUZZYVAL in non-fuzzy re-runlocStatus is %s; status has been %s; assigning status loopVariablesSingle returning status "%s" where status is %s and result is %s either, condition is true, or status fuzzy: condition %s; status %s There are deeper variables; processing the next one Status is definite, adding to resultThere are no deeper variables;%s either, condition is false, or status not fuzzy (condition %s; status %s) -- therefore dropping this one processLoc: from_locator %lx lost trueObj = %lx (not adding row - all fields NULL) (not adding row - some fields fuzzy) outputting via table for %x, using all rows outputting directly for %x, only ever using one row (type mismatch in column %d - value = NULL)Inconsistent value types in table column %d Value type was '%c' and now the field evaluates to type '%c' in row %dsfwReport() - type %c not supported for table exprDo we already have a row like "%s"? (not adding row - exists already) (adding row at line %d (%d in consumer)) incorrect expression type (%c) for unary MINUS operatorincorrect expression type (%c) for abs() ExprFuncXXX expr eval with fuzzy vals XXXArithmetic exception - division by zeroinvalid expression types (%c).(%c) for arithmetic operatorinvalid expression types (%c).(%c) for modulo operator (integer only)operand of date-function is not a DateTypeSorry : Unimplemented date-function weekdiff()invalid expression operator type in evalExpr() - EXPR_OPevalExpr - EXPR_TABLE_FUNC ->left->value.T == 0x0Only min() or max() function can operate over DateType values!Only min() or max() function can operate over Text values!Table selection returns wrong type of value. Functions min, max only work over columns of Int, Float, Text or DateType values, Functions sum, avg work over numeric values only.evalExpr - invalid tableFuncNode->operatortesting exists (exprNode->left=%lx && exprNode->left->loc=%lx) BOOL_EXISTS node should have ->left and left->locComparison involving boolean values only allows = and != operatorsThe like operator can only be used on Text typesComparison of two object values only allows = and != operatorsevalBool() - invalid date-comparison operatorillegal value types for comparison operatorevalBool() - invalid operator in BOOL_OP-nodeevalExpr - invalid exprNode->typeevalExpr() - produced FUZZYVAL in the non-fuzzy re-runevalExpr result, isValue = %s:stringComparison() - invalid comparison operatorintegerComparison() - invalid comparison operatorfloatComparison() - invalid comparison operatorboolComparison() - invalid comparison op - should have been caught by aqlError 885keyComparison() - invalid comparison op - should have been caught by aqlError 886valueAsBool() - inNode is NULLevalIntArithmetic() - invalid exprOpevalFloatArithmetic() - invalid exprOpBltttt"tttt"1& J `1 ,&%e#''<httttttttttttttttttttttttttttttttttttttttttttttttttttttttttttt9/,+,,,+,,,,,,,e,J,2v2,32,3v2,3,3,3,3,3,3,322/?}?}?}?}?}?}?}?}?}?}?}?}?}?}?}?}?}?}?}?}?}?}?}?}?}?}?}?}?}?}?}?}?}?}?}?}?}?}?}?}?}?}?}?}?}?}?}?}?}?>}?}?}?=Y<}?<}?Y<}?}?}?}?}?}?}??>ArXrXrXrXrXrXrXrXrXrXrX,G(GrXA=NrXvO*OU1AJAZAjAzAXAF7FYFvFFFFGLLGGGGMXXXuM=MXYMX=MXXXXXXXMMoSSTSSSGTkYY'ZYYYYZZZZZZZ*[a[[A[P[u[[GCC: (GNU) 3.4.3 (csl-sol210-3_4-branch+sol_rpath).symtab.strtab.shstrtab.rel.text.data.bss.rodata.str1.1.rodata.str1.4.rel.rodata.comment4^ h( %`^ +^02^h?2HbcR~N  Z44hcԅP % $B &>"V(n.7{Q|d<%n!|8_@Pa]8 5AxE35)/8[ ]hq]i\d[W.9YQ?\MZ_ [ ow~=;+6DQbp{ /7BP[fp{/?IV`u'6aqlrun.c_unameunamestatlstatfstatmknodbitFieldpostAssignTypesAndClassespostTableTypeCheckevalTableloopVariablessfwReportevalExprwakeUpLocalindentwakeUpFollowclassNextKeyloopVariablesSingleprocessThisLocAqlValueEqualevalIntArithmeticevalFloatArithmeticvalueAsBoolboolComparisonstringComparisonkeyComparisonintegerComparisonfloatComparison_nuname_xstat_lxstat_fxstat_xmknodaqlCheck2aqlTraverseaqlEvalmessStatusaceOutPrintuMessSetErrorOriginuMessCrashtableMaxlexword2keyaqlError_VClassmessprintfaqlNodeTypeNametableClearuStackDestroyuDictDestroydictHandleCreatetableSetTypesuArray_dbgtableSetStringstrcmptableUniontableDifftableIntersecthalloc_dbgstrcattableSortbsCreatebsFindTagbsHandleMarkbsGetMarkAsStringbsGotopickListnamepickMatchCaseSensitivelexNextaqlNodeOutstackText_dbgstrcasecmpstrnew_dbgclassNamelexAliasOfuArrayGetuArrayDestroy_dbgFREE_LOWERlexCreationStamplexUpdateStamplexCreationUserSessionlexUpdateUserSessionbsGetTimeStampaqlLocOutbIndexFindbsDumpstackHandleCreate_dbgstackExtend_dbgbsPushObjbsGetKeyTagsbsGetDataaqlLocSourceTypeNamemessIsInterruptCalledbsDoDestroyaqlNodeValueOutstackClearpushTextcatTextdictAddtimeDiffYearstimeDiffMonthstimeDiffDaystimeDiffHourstimeDiffMinstimeDiffSecslexstrcmptimeComparisonregExpMatch %%5&M'e()++-$,.>I.di/pu0./01./2AQ3q4}2342&63\a/hm0/0/05 -3L3}53/380JO/_6hm0 3\lw.789 : ;  <   <8 G <M [ j <  <   <  <   <$ =6 E <M d i /p u 0  /  0 >& 6 3b ?u @ A  /  0 % B  5 C  5 C  5 C  / 0D:?/FK0~/0/0 ."ECFjGH.IH./@3mu.EGH.IH%-.mJtK|LMM.)N3DNa/0.;B\O}/0.S^PKQ3 PZmRuQ3PSJ3T UOb3r}PPPP3VVbWXYZFQP`kPzPVV [33.J]3K.=2u3K.K.\.9.EVN3]  K% K7 B .  .  .!EC!KO!Z!.e!^m!x!.!F6"E"_z""`"G#H#!#.V#a#.s#x#/##0##.E$X$3$a$F"%GZ%Hr%K%%.%%.&1&&. ''\''.''.Y(l(3((. )a)b)K)).**_**`?+HN+Y+.+G+H++.+,b#,cA,c\,cw,c,,/,d,,0,,, -.-e -,-3O-Z-.f-w-N--\Q.\.\...//.Y/d/./H//./I70<0/C0H00r080b00.=1B1/I1N10m1I181H11. 2G52HG2R2.r22b2c2c2c2c 33/ 3%30p3x3.33.33.+404/74<40m4w4444444.44444.35;5\N5\5Nf5t5N55NB6K6Q6[6e6k6s6.6666666.67.E7O7U7]7.7777777.77.8fl8>8888.88N>9gF9N9.99.99..:6:.D:1i:q:.::_:h::i:;<;(;6;j;9;:< <.-<;<3U<_<w<<<<<<<<<<<5<j==<*=8=L=<\=a=5s=j==<===<==5=j> ><->;>O><_>d>5v>j>><>>><>>5>j?=#?j5?M?<\?f?t?j??/??0??O??.@ @O1@k[@c@.@@. AAN-A>BNB3BC3CC/CC0D,D3%E5E3EE3EE3F)FlKFmZFjF3FnFoFpFqFG/G G0bGgG/nGsG0GGHHHHzII JJJ3vKKOKKOKK3K LOLr4LrLL3L9MMMONN/N#N0^NfN.NNNNNN. OO/OO0OP3PJPK&QKjQKQKQJR!R3OR_R3kSSsSsSsSsTs/Ts^Ts{TsTT/TT0TT3pUU3XX]X/dXiX0{XX/XX0XX/XX0XXXXY Y.YgY'Y.HY>QYPgYYrYrYrZr3ZLJZtdZiZ/pZuZ0ZZZ/ZZ0&[[[/[[0[\/ \\0=\SG\S]\Sg\S\\/\\0\\/\\0R]W]/^]c]0]]/]]0]].  $(,048<@DHLPTX\`dhlptx|  $(,048<@DHLPTX\`dhlptx|  $(,048<@DHLPTX\`dhlptx|  $(,048<@DHLPTX\`dhlptx|  $(,048<@DHLPTX\`dhlptx|aqlerror.o/ 1133374755 530 202 100644 2316 ` ELF4( UuUuU u ujU u ujU u ujUuu ujUWVS\u }ujAh$ujEpUBr jLhr(h}GjMhw(hGEPuw}E EyE] UEǰI9rэY+]ĉ]@PUEP]S}D=h E+EPSVh4Ep Vh Ur}}?tj; u_E@EǰD// +EPuUr}}fD SUC;u}}D// uUr}}fD VUraqlerror.c^// AQL error %d: aqlerror.c:aqlError() - called with NULL pointer// AQL error %3d around: '%s' // %*s GCC: (GNU) 3.4.3 (csl-sol210-3_4-branch+sol_rpath).symtab.strtab.shstrtab.rel.text.data.bss.rodata.str1.1.rodata.str1.4.comment4 D %+02 ?2qNu4W   &>$V*n08?GOW%`taqlerror.c_unameunamestatlstatfstatmknod_nuname_xstat_lxstat_fxstat_xmknodaqlErroruMessSetErrorOriginuMessCrashlongjmphalloc_dbgvsprintfstrncpysprintfstrncatstrcat 5Me       }aqldebug.o/ 1133374756 530 202 100644 15120 ` ELFl#4( UuUuU u ujU u ujU u ujUuu ujU8hhPE8UXhhPEXWV4L D$@4^_UVSu] tFhdV$hzjsV jjsVhVe[^UWVS ] uE=EEPuу|1 t.Vhuuu\EuFPPhu 3PPhu{tshu{tshu{t s Phu;,u${0uPhu;'us0hu;(us0hu;)uC0d$$hu;*u s0 Phu{$hu s$huC$x uhuPC$9X tH@ 8 u@=u7 jhE@PC$@ pu C$x(tp($huhu{t uhE@Psu { t uhE@Ps u {t#}u jhE@Psu FPhuuu 3PVhu {tshu{tshu{t s Phu;,u${0uPhu;'us0hu;(us0hu;)uC0d$$hu;*u s0 PhuShu{$tPs$h uC$x(tp($huhu{t uhE@Psu { t uh#E@Ps u {t uh*usu }th1ue[^_UVSu] uh3VC4PS PhCV{,uhTV{,uhYVC4f$x s0Ps0h_Vys0hfVcC0d$$hiVIs0hlV3 s0 PhlVs0hoVhrVe[^UVSuE ]=t(PhvV C phzV3PhV ShVC pPhV ;uhV ;uhVCPhVCf$=t" s PhVss PhVcshVMCd$$hV3 s PhVshVh1Ve[^UWVS]u}WS~ u hSu WS\hS$>uWS7hSPWShS8uh'S jh,GP0S ~uWS h6SRWS hNSF8uh'S jh[GPF0S ~uWSO hfS jhwGPvS e[^_UWVS u u!hh$}t' V ~huE>, $ V Phu4$ LjыEDEPjvuV LjI)Mm~ huuu ujvu V9 Phu4$ ыEDEPjvu ~u huuu ujvu ? V Phu ]SjvuF8tuu% E v Phuv)MF8t]Su ujv u~{ huuu ujvu E EEEE~ t3F xu* P 8uF x$t@$x(uE}thuhuE^ ujSu$ 8t]{t1{$t+ C$p ǰыEDE* S ǰыEDEE{thuE[Y}}^tx}t}uuu }t$}uhuEEujSu{thu[u~huEEPuujvu E]SjvuEuuThuE~ t)huEujv u 0~t* v Phuv]~huuuujvu ivhuvhыEDE~t&huEujvu ~huEujvu hu~ v Phlu V8t V Phu^tujSu[u~ * VMuu2huEPjv u vhuhuujvuhuujv uhua V8tU~t-~$t' F$p  Phlu V Phlu~t9F8t8t8t8t 8t8uh uh u v0 Phuvhue v0 PhuA~tvh#u vhuvh'uvh,uEPjvu vhu v PhluvыEDPjvu L v PhluvMujvuv vhu~u3 j Phluujvu FwDujvuv Phuujv u T v Ph0uujvu ~ t#huujv u huh4uujvu ujvuv Phuujv u xh<uujvu Pujvuv Phuujv u  Vy PhAuv0hEuv0hfuF0d$$hiu v0 PhlutJ~0uOPhluN v0 PhEu-hh6Ph$}t$ V~hue[^_UWVS}u h1W9}hWC9|e[^_UWVS Ex tP :tp2ÃXUt:޿\ 8tހ;_uShaƃe[^_UVSut# vCv @9}؍e[^**type unset**TABLE_ASSIGNVAR_ASSIGNTABLE_VARTABLE_OPTABLE_SFWTABLE_SFW_ALLTABLE_ORDERSORT_FIELDSORT_FIELD_NAMESORT_FIELD_EXPRSORT_QUALIFIERSELECT_FIELDFROM_LOCFROM_TABLECLASSOBJECTLOC_VARLOC_TABLE_FIELDLOC_TABLE_FIELD_NAMELOC_LOCAL_TAGLOC_LOCAL_TAG_NAMELOC_LOCAL_POSLOC_LOCAL_FIELDLOC_LOCAL_FIELD_NAMELOC_FOLLOW_TAGLOC_FOLLOW_TAG_NAMELOC_FOLLOW_POSLOC_METHODEXPR_TABLE_FUNCEXPR_TABLE_FUNC_FIELDEXPR_TABLE_FUNC_FIELD_NAMEEXPR_OPBOOL_EXISTSBOOL_EXISTS_TAGBOOL_COMPARISONBOOL_NOTBOOL_OPVARTEXTINTFLOATDATEKEYBOOL**op unset**unionintersectdiffascdesc=!=like<><=>=notorandxoryeardiffmonthdiffweekdiffdaydiffhourdiffmindiffsecdiff-+*/countfirstlastsumminmaxavgabsmodulo**src unset**IS_CLASSIS_ROWIS_COLUMNIS_OBJECTIS_LOCAL_TAGIS_FOLLOW_TAGIS_LOCAL_POSIS_FOLLOW_POSIS_METHODIS_EXPR canonical query : canonical %s: () %c%c%c%s "%s" %d %sTRUEFALSE %g (loc %lxNULL_definition!<> ){} [] %c%s %s name "%s" number %d op %s %lx (loc=%lx, %sleft right next (NULL AqlNode) (`%s' [%c-value=NULLFUZZY%x"%s"%d%g%s%x]) %s name=%s%-10s loc=%lx, (def=%lx)->name=%s NULL FUZZY type=%c value=%s value=%s(%x) value=%d value=%gCheckEnv at %s: null_envnull curr_decl_pointercurr_decl: nullcurr_declnull curr_Where_pointercurr_Where: curr_Wherenull CurrFromLoccurr_FromLocaqldebug.c(@%s := ;$%s := @%s %s select all select , from order by :%d ******************%s in where class %sobject(->0->%s[0][%d][%s]:%s->%d.%s%s(exists not $%s"%s"truefalse(null)_DEFtmp%s'1:DR^iy"2GVjy "&+8>HMQVX[`bdgjnquy)7DR\~FhF1 ~  ~ ~ ~ ~ ~ ~ ~ ~ j K  / 4Lzz'B,{W[?,GfNULL inNode in aqlNodeOutPretty()aqlNodeOutPretty() - %s should have been eliminated after check2GCC: (GNU) 3.4.3 (csl-sol210-3_4-branch+sol_rpath).symtab.strtab.shstrtab.rel.text.data.bss.rodata.str1.1.rel.rodata.rodata.str1.4.comment4* x)P %`+d02dgC? 5H K2p"eZ"4 #ct%  (b &>$V*n07G-DNq~V; ckrz..!\bP  G  }/CNYaqldebug.c_unameunamestatlstatfstatmknodlisplyin_definition.0indentvarNamenestingLevel_nuname_xstat_lxstat_fxstat_xmknodaqlNodeTypeNamememcpyaqlOpTypeNameaqlLocSourceTypeNameaqlQueryOutaceOutPrintaqlNodeOutaqlNodeOutPrettytimeShowaqlNodeValueOutnameaqlLocOutaqlCheckEnvOutuMessSetErrorOriginuMessCrashmessprintfdictName 5Me    + 6F N Tz    1 9M Uir z       ! 1 9D L` h    , <U eu }     $ / 5 =P Xk s !     4 DX h|      #B M#Y _o u  !     ) /= CL R^ dt z   #  #   "  ( <  B R ![  a q  w            /  5 D  R m  s            ,  1 &8 = '_  g        #  =  E u           & 1 o      % -M  ' /K \ d      ,5 =H` h   (   ( 8 @]f n    . 6F N^ f n~    + 3C K^#g o #     < G Obk s~     +4 <L o z        #3 K V_ gw        3 ;R Zm!v ~   #  &' = CW ])    (         $ ( , 0 4 8 < @ D H L P T X \ ` d h l p t x |                                          $ ( , 0 4 8 < @ D H L P T X \ ` d h l p t x|  $(,048<@DHLPTX\`dhlptx|keysetdump.o/ 1133374757 530 202 100644 6540 ` ELF 4( UuUuU u ujU u ujU u ujUuu ujUWVS u }t Ex u jEhjjj C}tUzuzujHh$ h M9q }q CЈ9~ jPhjjWƉx EP JUjUhuuE[tNF NE 9}QCV<tPFPUuCV<tPEPUtM}S jphjjWEGMA j%EGE]UZ FtNF NE 9}4F;Et!CFPFPUuCM}uMA U;B }B thhVEe[^_UWVShhjjj EE Ex OhhWu0Ep NteC=%,u= 3u+C;thhuEuNu}thhuu O1Ex OhhWu;hjREp NteC=%,u= 3u+C;thhuEuNu}thhuO!huu}thhuEe[^_UVS]u S9t! QP3$ 6P3$e[^UWVS }E p xuZNtL 3t2 3$P3 PhWNuЍe[^_UWVS] hjSE S$ Ph uw Ntn 3tT}uh-uE 3$P3 Ph/uNuh8uthhWe[^_UVShju Ãt-Suƃth hSe[^UWVS}hhjjj E j VÃuEj:W<$ƃSEPV hEPu WtEPh:WƃgEx thPu }th4hu]u@Pu PWPh0U}th<hue[^_UWVSuhLhjjj EE StEj:V4$Ã}uEku V PhJu HE;u t7uEPSthihw WUE VÃI Vuڃ}tuhfu _ hW<$9_ t+G Phhu e[^_UVSut~u~t ~u^ KtdhhSV AtBt* R Rt PKue[^keysetdump.cHeapingk%s : %s ?Keyset?%s? ?%s?%s? :-/" void line// No object name, line %d // %d objects not recognized keySetHeap received a non-magic source keySetkeySetParse error at Line %7d KeySet %s, bad word %s // %d duplicate objects removed GCC: (GNU) 3.4.3 (csl-sol210-3_4-branch+sol_rpath).symtab.strtab.shstrtab.rel.text.data.bss.rodata.str1.1.rodata.str1.4.comment4  <P %8 +8 028 ?2 NE 4y W   & >&V,n2:AIQYdu@#/9GQbXblq|9 CYi !.9IT `_ke vkeysetdump.c_unameunamestatlstatfstatmknod_nuname_xstat_lxstat_fxstat_xmknodkeySetHeapuArrayCreate_dbguMessSetErrorOriginuMessCrashmessStatusuArray_dbglexMaxuArrayDestroy_dbgkeySetNeighboursbsKeySetpickListiskey_VUserSessionmessIsInterruptCalled_VKeySetuArrayGetkeySetOrderarraySortarrayCompresskeySetAlphaOrderclassNamelexstrcmpnamekeySetDumplexIsKeyVisiblefreeprotectaceOutPrintjavaDumpKeySetfreejavaprotectkeySetDumpFunckeySetParsepickWord2ClassaceInStepaceInWordlexaddkeyarrayInsertaceInCardaceInWordCutarrayStoreaceInStreamLinemessprintfkeySetReadlexword2keykeySetKillarrayKillbsUpdatebsDoKill 5Me    6 @b m 2   +U ^h    1 :J!X `"  #$!%7 ?p'{'())(+), ' -F N"p)x/ -+ -)/' -  -) /L V"p*  2345#(647G M8k t9  ): ;   " C 2X 3` 4} :  - ! =   4 7   -( #. $6 %L  T -    ? @ Alexsubs4.o/ 1133374757 530 202 100644 29288 ` ELF@4( UuUuU u ujU u ujU u ujUuu ujUWVSEEEE@<tLE 4@ NjP U @Q UPPAA‹@ PUKuJ BBEE8EUE UEEUU Ee[^_UWVS hhjjh hhhPRƒA9Kty@@@(@@@@ @$@@KuD@ j$e[^_ËL$t4AA+A  UWVS }@<t50X Kt'~ tFBP Kuٻ@<th h4@<th h4@$<th h4e[^_UWVS @ @(@@@<t 4@<txuxt @ @ S@<thh4@@C9e[^_D$@UVS]@<h1hjAt S<@ tZS Ph VP$$J@@ @ jS$1 Sn@@ SEPjt Ve[^USh[hjà jEPht) utL j 5@ jEPh%t) ut@ j+jEPjh+SPt) ut jjEP5h+SPt. ut@ Pjt S]U@Dj{$$ËD$@USu j.<@t$ S$$$CKu]UVS4uVh+EP t ~PEPEP t ~PEPEP@ <t 4 u@ @e[^UVS]hhj<@t ~PEPSh+VP t ~PEPSh+VP4@ u@t Ve[^UWVSuhhjǃ t ~PEPVh2WP t ~PEPVh2WP@<thh4@h:juu VR@P C9|9t#hhVh<@@t We[^_ËD$@UWVSuhhjǃ t ~PEPVhVWP h^j uÉ4$@u#hhVhd@@ HtB b Hu@t We[^_UWVSh/hjEfE<@Ut }~VPEPuhVuPU@@Ep Nt{ u NuhDhjU4@Ep NtX{ tI{9x |!hKh$wPC C Nuh^uuUE9@tthThR}t ue[^_UWVSuh^hjE t ~PEPVhuP@$ hjuu& hfhjj@p  @@$@ ;B ~ VPh@$X @9X ~D@$hvhS4tHtD C@9X @( @(}t ue[^_UVSEƁ~@<@$u Sp@$9p |hhVPCe[^UVSuhhjtr<@(tht ~PEPVhSP h4@$u@(t Se[^UVSEƁ~;<@$u Sl@$9p |HE  @(e[^UVSEƁ~9<@$u S @$9p |@$PЍe[^Uu$UVSEƁ~:<@$u S@$9p |@$PTЍe[^Uu$UWVSu} VÉ4$t;CCs xe[^_UVS] SƉ$t@e[^UWVS}u W=t 0A=t Xp+hh<$Ph9tK@~6@(hh%P4@$Ce[^_ËT$t$À:tBt:uUWS]; t; u C; t; th7hu SÉэTJ9v: t: u J9w؍e[_UWVS}hHhjE WEPutdE%;E u} uhRhh0h`uu WE%PWh0 WÃu} u] ;] sCWEPShuPC;] rՃWE Pu;] uWE Pu U PÃu huPS t&hhhSu uh hkhu 4@Ã@ 4uuP4@@@<$}t ue[^_UWVS ]߁t V9w~@Bx t@B‰t&9Z t!hh$xu=te[^_US]E Pt@t@9u޸]UWVSuVt @ukx`H@@ S@@ HtBt9ruz Hue[^_US] St@tX؋]US]St @ t?Hu&u BtЋ]UVS]ރ StABt5Z9u݃h h$! PSh믍e[^Uut7=uxzu:t‰UutUutUVS5 uLp h8hSPBƒ9~A9h<hV5‹ e[^UWVS}Wu+hIh<$Ph =t =sCB hShP50@@Ë@%BDt3@P|PDuҡx e[^_US]St-@t SPh H]US]St @t`+hh$Ph]US] uQtX ]UVS]S1ƃ} w;E :t1EPE P;E u F "E:EuЍe[^UVSuE EVÃ}u/=u`=thhp P0t EC+hh4$PhDe[^UVSu] V,ƒt Ѓ B+hh4$Phhe[^UVSu] Ӄ Vƒt@Jt X Jue[^US]St@0hh$Ph]US]St'hh04@ ƒЋ]US]St'hh04@ ƒЋ]UWVS]SE$ƻ}҉Ѓ;vb=t 5}҉УhhjPuVh5e[^_UVS]u >t8;$t+hh$kPh>u$(6= t @urkd @( 5(tС@ttơ@(ˡ 5(e[^U uu u$ËL$ʀ9:t:uB::uD$BD$ UVS] EPEPu t3 uƒtE@:RSutfe[^UWVS\$|$|$  );t$$Љ Ћ$1C;u܉Ӊw 1v|$ tH!؃[^_]UWVS uG؉P$d$]VP$ Et͉<@ h{hjS4@@ h|hKSP@X KtSVKue[^_UWVSEEE %EU@,}u&U@H ,@ Eu u E EP.E8j@U4PU U,B 4]KB< tC>tz}ujE4@uE U49vE)Ku}t*hh5hEEe[^_UWVSu5‹EEэYЃ:t @8u} I9v<5 @ E4E@u 4u R@t`E@uuE@e[^_Uu=t3xu(xu"B@ 5UWVS]} uSx@u H@ =t5u% S8t @8u W`@e[^_UWVS uEÍu Vt @ t  VtS}t VPh '}t! V Ph jUduu E 4$Eu P ,=thhuuEu u׃uu V4$%g}u3SEPu uu V4$.SEPu utW}t uPh )}t# u Ph jU(uVtH}tu uh@ }tu uh@jU VuuuV2 uuE ulj4$ uE uPVu Bt?}t hp}thpjU}tP u$ uPV PhuPuV uuVu4$VS Bu VǃPV<$ P=tuuVЍe[^_USEE )t Q PS$]UVShhjÃPjuuu u\ƃ t Se[^UVShhjÃPuuuu u ƃ t Se[^UWVS4uEEPEPUEuEv%h9huhE<@u PE<@t>t<@t @x uE jVhHhjE4@ E؋U@E܃ j@URVW UGMIGЉE σ;u/E @,t V@U܋EPVUԃumE ЋU @U܊D "E:Et'D,t Vvt VY}ujuVE E;]vE)O@,t Ve[^_UWVS uE]}SVue[^_UWVS} EPEPu tE<@u P:?u/}u@E BKlG;Et[ EPP7 P7Ph0E EE¹@<su ;q A1 ];Y }uFuZu#F "E:EuKځ ЉQ EځU P@ "E:EF CU@;X |e[^_US]S= Suyxt#@@ P@u H@ P@ =t50]U jEPuEUWVS0hhjẼEPEP@,D,}t?uu uu =D,t}t uE<@u Pk@,u@<c@ h%hjhE4]$'hjj h]h)hjjh@$]@(@h,hjjh h-hhE4U@t@ Bu.REPR PhuPuEPht$ ut u}@@,U@@ EЃ}u-w(U }t uBuuEt8u1hEhE$Ph`}w0 E4@ Ë}эLy;hJh E4@ Puuh @ E4EEEEEuE4hWhuл@E4U؉U܉PUP =@,t$V*n06 C@I@ M@Z@d@n@(x@@$@@=@  x Vd c   #(6aD6$M$ValJvZ $(12!e,}"#b$,@,D, 0")19AQZd]4l}S  #-D7.AKSu)d_Uhnv~BC^ !5@NYbn}\'ab Ff0[b  J%_23;kFQb33Jipy @1q(N\S!p @*[9qRFTWblw&!cic#d#O)2?K(F^h(Pq$)Q|+;,-i.}33)3o4 #(0DV\mlexsubs4.c_unameunamestatlstatfstatmknodLexi2minFreeLexi2Lexi1VocLexHashTablelexhmodifleximodiftimeModifvocmodiftimeStampsnClasslexIsReadlexi2clearlexi1ClearlexSessionStartSizelexReadTablelexvocreadlexireadlexhreadlexReadTimeStampslexiwritelexvocwritelexhwritelexWriteTimeStampslexKeyUpdatedKEY2LEX2KEY2LEX1myKey2Lex1myKey2Lex2nakedNamenewLexi2buf.0buflen.1lxp.2lastKey.3kk.4colonParselexHashInserthashTable.5lexHardRenamelexMakeAliaslexRealAliasKPisSubclassFailInWord2keylastSession.6_nuname_xstat_lxstat_fxstat_xmknodtouchedByClientlexavailstackMarklexInituArrayCreate_dbguArray_dbglexDefineSystemTagslexReHashClassuArrayDestroy_dbglexClearuStackDestroylexTableReadhandleHandleCreate_dbgpickListpickClass2WordhprintfmessStatuslexClearClassStatuslexaddkeyuMessFreelexReadlexword2keyiskeyold_VBat_VClasstagInitsysClassInitclassInit_VModelsysClassOptionslexReadGlobalTablesdiskPreparelexmarklexSavelexAlphaSaveAllsprintfstackGetisWriteAccessstackStoreuArrayGetuMessSetErrorOriginuMessCrasharrayCopy_dbgarrayStoremessdumpthisSessionsessionUserKeylexSetCreationUserSessionlexCreationUserSessionlexCreationStampsessionUserSession2TimelexUpdateUserSessionlexUpdateStamplexOverLoadlexDisklexSetDiskiskeynamelexIsGoodName__ctypelexcleanupstrnew_dbglexHardDefineKeylexMaxstrcmppushTextlexAlphaMarkisNakedKeylexAliasLooplexDestroyAliaslexAliasOflexIsKeyVisibleKEY2LEXlexlockmesserrorlexunlocklexSetIsAlexIsInClasspickIsAX_CLIENT_PARSINGlexSetStatuslexUnsetStatuslexGetStatusstackText_dbgnameWithClassclassNamehalloc_dbgnextNamelexReClasslexClassKeypickWord2ClasshashTextFREE_UPPERuArrayReCreate_dbgNICNIIstrcpylex2Checklex2clearstrcasecmpmessoutexternalAliasmessQuerybsFuseObjectsbsCreatebIndexObjectbsDoDestroylexNakedAlphaOrderlexstrcmplexAliaslexDoAliasNWGNWFNWClexLastKeylexNextlexkillstr2tagstackHandleCreate_dbgstackTextOnlylexHashMaxvocMaxlexSessionStartexternalSaverlexSessionEndkeySetOrderarraySorteuidseteuiddbPathStrictFilNamedbPathMakeFilNamemkdirmessSysErrorTextaceOutCreateToFileerrnokeySetDumpruid <<5=M>e?@Cm{EF%>IXG^hvHH.6IEX`IoIK.AIIZeMNNO PQ1;FRcnSTMVWX Y.3VEWRhGmZPVW[\]PVW ])^6TJTkHp`c d-SQSYjKeMf P S. 4 P= SG O gV j T  M  P S  P S   I+ 3 = hP H\   i  j   T   M # P, S4 > hM d i ir w j   T  M f 3 ; PD SQ \    k   i  j   l( ; A IU Tv } M  P S   h   E $O-$2m<FPZcFin{nT Fo9@MGfU|PSlTI_pqstsyizj$2AFFMo|~M(VQTfkip$u$$jPSS S.z;CPMafir$wjFC}T/<FXevij)5GS\o|'NHNjwi$jyy.@yRajwFFy iz$#j,4DQbpw|F0z9>izjdmAzAFiz$j iz$jBRiz$jy!/4BGezpT d8GLi]$bjpv~ z(VV }  2       F @!E!U![!2c!|!H!!!!"$"="B"iK"P"$U"jq""""C"###4#P#n#yw###########$+$:$?$O$$$N$$$$$z$$$$z%$ %P*%}5%zD%Z%g%r%~%V%S%&z&$ &6&z?&$F&Pd&&$&&$&P&&D'NU'$Z'm'$t'P'z'z'z'$'P''+(N7(C(K(\(e(x((((M)T2)9)Me)T)))N)))i)$)j)**!*E*}Q*]*b*o******T6+@+M+T]+j+T++++T+),E,~,N,,,z,$,,z----y---...0.=.E.O.X.y.S..M....V..T/&/5/D/N/Z/k/z//E//E/////E//F0(0N<0OE0M0PV0Sh0m0S000T0}11i"1+1$01jI1N1Cy1~1i11C1$1j11C1111F2#2122;2R2Hv222F22F2o222223TP3d3333C3333R44A%4+4A04I94AC4S4^4Ec4A~44E44E44M4n44T4N 55&575c5o5F5555F56!6*6/6:6?6D6I6N6]6b6g6l6|666$66n6z66P666666$6 7$7!7n&7z/777P@7E7P7V7i7u7z777I77777777777788!8+8$08A8nF8zO8W8P`8e8p8v888$88$88n8z88P88888 99%9-9I69AF9L9AQ9IZ9Ao9Tw9n|9lexalpha.o/ 1133374758 530 202 100644 5148 ` ELF 4( UuUuU u ujU u ujU u ujUuu ujUSEE PPS$]US}t+=t+jEh5=uV jHhjjj jJhS5Kuh5]UWVS,ut~u ~t~t ~ t} u j\hjjj hjP~ + jbhjjv jchv PDž>v NtH 7É$tPuP hP>N ItJ_uƄj S?tj 7uE 9F }v u hhjju hhE HPDž$hhVtk S 8@ HtG 7 t$E 9tuFcJ Ѝe[^_UWVSuà hhjjPE hhKSPE8ut Vt7FKuU+B hR hhjjj E E<t"hh4UUE ƀ ƀ e[^_US]jEP Sh P hju ƃ ]US]=t/ ƀ ƀ Hu倻 t SJ,< u" SE< u S]US St SKuދ]USjEP Sh P t S t$ thPuƃ Ku]ËL$=t/ ƀ ƀ HuwƁ UVS ƃ ƃ <t9xu-xt'xu!th!hPKue[^US]S @ ]UWVS Et-x t'0X Kt 6Kue[^_UWVS EEU tp tcNt] 3tAM EEP3t E8tыELMtNuU :t Eљ9EEe[^_lexalpha.c_lexalpha%dkGCC: (GNU) 3.4.3 (csl-sol210-3_4-branch+sol_rpath).symtab.strtab.shstrtab.rel.text.data.bss.rodata.str1.1.comment4 @%+  02 ? 4M H(   2 &>$V*n07@EN WaIk u ~\O a$/?P^r53h~L2i"L )lexalpha.c_unameunamestatlstatfstatmknodclassAlphaOrderks.0alphaGetalphaSetfirstPassalphaMakeisTouchedisMarkedalphaRead_nuname_xstat_lxstat_fxstat_xmknodclassNamelexstrcmplexAlphaClassListuArrayDestroy_dbguArrayCreate_dbguArray_dbgarraySortkeySetAlphaHeapmemsetlexAliasOflexIsKeyVisiblekeySetAlphaOrderarrayCompresslexClearClassStatuslexSetStatuslexGetStatuslexMaxmessprintflexaddkeyuArrayGetlexAlphaMakeAlllexAlphaSaveAllarrayStorelexAlphaMarklexAlphaClearlexMaxVisiblekeySetCountVisiblekeyNamesAveragenextName 5Me  & -2 EKP!X #   ;$E%&!'()( 4G W   *V+p z  %&!    (BHOq v,- .F+ ,- 1 ,=CJz %>%_7disknew.o/ 1133374759 530 202 100644 31908 ` ELFR4( UuUuU u ujU u ujU u ujUuu ujUS=th jjh hhhj5$$hhjj5((hhjj5,,hhjj500hhjj544jju!hh$!]UWVShhjj500hhjj544hhhj5$$ c$;=@ WhhW5$ÃVt V=t>PP3Wh4h 0G;=@g hhjj500h hjj544h hjj5((h hjj5,, e[^_UWVS EEu!h'h$ hKtl5= tC) jt=t)PuEhKuEЍe[^_U=~Un hPhjjjdhQhjjjdhRhjjjd@jUWVShihjhEhkh5@5$ǡE u!hsh$]ЅyB?)¡)ЉE}tEE*=u!hh$@ E=tPh8h EEE;E}!hh$l;E@@@;D| hhh5@5$NjE5@kà P5@ht S 5@/Ãu*E$ 5h9Sƃt4t!hh$E FGKuEEe[^_UWVShgjuE hgju E hgjuƃ hgjuǃ}}VuÃWu t WV VU<$ U hgVu hgWuuu thhVthhW}thhu}thhu؍e[^_US 5uÃ5u o t55v]UWVSl$t}u }t] tGuKt6>u%>t щ!ЃvFKuʋE )[^_]UWVS }] u=u5V5IU59@ +EEht 76E03h e[^_UWVSE8t*‹@;oB;_V=uMyt Qx UWPMT U8P4 ;urO>+EEEЅE8UPЅtJ8Pt8@u88UB ^h`h$PF;uruO je[^_UWVS E=uB@ 9w+hh$ A9 AEP0كu+hh$t  E e[^_US]=t^@ 9w+hh$Pك]UWVSEEUE=u}x@ ;E1hh @ PuhEPuÃy!hh$Phhu540N u1Eؾ5=tfjVuƃ5y,jwjo=P Puhth hu54Vh hu5, }t uy!hh$iUhhu5,U+U= tuSuuhh =huh@E@UBBt:BAt@CtSu6 h@E h@3 h@!h,h$ 5}juVÃ;EtlPSuuuPh< ;Gu5jwja7PPuuPh huVÃ=u 5hKhu5,UډEܣ e[^_UWVS$EEUEPu KEy!hlh$Phnhu50K uǃ jjPÃy*jrjoP PWhPh~hu50Shhu5( t Wy!hh$iEEhhu5(}+8= t!uuuu hh jWSǃ;EtoPWuu uvPh< >Fu8jrjaP Pu6PhhuS=uhhu5(U=teUBBt(BAt,CtSu"A u1 u!hh$XExSt(U 9t!hh$ u u hEe[^_UWVS}EjWÃy*jrjo;P PWhjjSƃy PWhl Sy =tSWhh E؍e[^_UWVS ;=@1 VÉ$ǃt SF;5@~σ=tWh/h e[^_UWVS }}h!hj5$»;@S9v2= t E)PSWhh E E)GC”;@~h3hWhFe[^_US]x $9X -hChSh hFhS5$ƒt5hIhjPPhbPjhhPhi]UWVS E00x Ot=Kx/ StPh$ Ouà hqhjj5((4 0x OtZKxL 5$Ã5tPh$ Ou hhjj5,,E e[^_UWVS(Ejhrhthihxƃ =tPh~h Et jhhhrVE4$}} h\ hhj5$@locaf@lǀACEDfǀBfǀǀ@D q}uc} u4V uƃt(;D} uuDEE^ uƃF8+hhuE5$Ãj:uSu uƃtqPCPutRVPut0VPtPuu: u HPjhthihxPh 8uƃ8u ƃEH~n$PWRu;Wu HPjhthihxPh FEH9E侓ǹ 8t6 jhrjuhiƃ t P4$ǃ u u}t @EDh3hj5$Í 8u}~ Ee[^_UWVS5jhhihiÃhPǃt SuUhhPh ?Ph 5@5DhW;5DhhV5$Ã8PPPPuDžACEDfDžBuDžNONEƅ jPPCP3hW0F;5D. W5e[^_UWVS hhj5$$hrhthhiƃ u hT  V0u!hh$ t VClocafClƃf@D:jj=Duǃe[^_UWVS EEhhjE$hrhhihiE tjhhhrPE}u2[jhhhruEuD uuuh EE@D~ u8gh hu5$DPu uPCPutdPPutBPPPutPuu u HPuhd 8uƃ8uƃE䉃EE䉃~E@E ul uDjjt 9D~KE}t ue[^_UWVUM q8I tq 11`">==B^=jrtot j$WVh h ]jdh h Ajwh h %otPh h hh h  h fotPh h jQh h hrtPh\h Xhhh <jKhXh #hhh  e^_DataBaseCreate disknew.cSaving...open (for appending)abopen (for writing)wbdiskWriteSuperBlock c Writing BAT, address %dp-%dm-%dInconsistency in fuseBatsDuplication in fuseBatsACEDB_DEBUGdisk alloc inconsistencydiskblockwrite() - fd < 0diskblockread() - fd < 0PartitionSize : %s = %d total Base size : %d impossible disk address %ld%s/%sdatabaserwrmwspecopening def file %s blocks.wrmPARTACEDBNONEmapw%d %d %d %s %s %s %d %d %d blocksreadablewritabledirectorypartition fileopen a newaccess a DataBase creation : no description file found !!! Partition %d: type %d, f system %s, file %s currentBlocks: %d, maxBlocks: %d, debut: %d, fin: %d Sorry - bad cache structure - in saveAllsaveAll: pass %d: wrote %d blocks diskExtend() called without Write AccessNo batArray in diskextend(FALSE)diskExtend : current blocks number in bat = %ld Diskextend found a physical size shorter than expectedCan't extend database. You need to add partitions. Please edit wpsec/database.wrmDisk extend: Creating partition %d: %sError occured when trying to %s partition file %s (%s) %sI will have to exit now ...Error occured writing to disk (%s) %sI will have to exit now ...Now %ld blocks, %d in partition %sdiskBATread() - Cannot arrayGet the Global_Batno bat self reference for address %dbat size inconsistency in diskBATcompressdiskBatCompress releasing a non set block %c %cdiskavail: used %d, plus %d, minus %d, free %ddiskfree called with a wrong disk addressdiskfree called on free block Diskblockwrite called with wrong DISK address d=%ld, max = %d Bad Block Address in partition Error occured when trying to open (for read/write) partition file %s (%s) %sI will have to exit now ...diskblockwrite: d %ld, part %d adr part %d offset %ld unknown block type trying to swap dataError occured when trying to access (for seek) partition file %s at disk address %d (should be pos=%ld, returned=%ld) (%s) I will have to exit now ...Error occured when trying to access (for writing) partition file %s at disk address %d (%s) %sI will have to exit now ...Error occured when trying to open (for reading) partition file %s (%s) %sI will have to exit now ...Diskblockread : d %ld, part %d adr part %d offset %ld Error occured when trying to access (for reading) partition file %s (%s) %sI will have to exit now...Diskblockread : unknown block type trying to transform dataDiskblockread : read a block not matching its addressDiskblockread : read a block not registered in the BATError occurred when trying to open (for reading) partition file %s (%s) %sI will have to exit now ...Error occured when trying to access (for seek) partition file %s (%s) I will have to exit now ...pour adr disque %ld adresse part : (%d,%ld) PartitionName : invalid number %d Error occurred when trying to close a block file (%s)No DataBase Definition, default to standard unix fileParse error in database definition file %s at line %dError in database definition file %s at line %d. Partition name %s already exists!Unable to update database/database.map file (%s)Consistency error - No DataBase map and no old style DataBase (i.e. database/blocks.wrm) You may have to re-initialise the database old DataBase (database/blocks.wrm) is empty !! Error in database map file %s : Unable to read first line. The file mustn't be empty !Parse error in database map file %s at line %dCheck that the database %s is %s by %s The maximum file size has been exceeded. Please check the 'max_size' number in wspec/database.wrm. The quota of disk-blocks or i-nodes defined for the user on the filsystem containing the database has been exhausted. The attempt to %s partition file was stopped by an interrupt signal You have reached the soft limit for open files for this process. Type 'limit descriptors' in your shell to check the maximum allowed. The system file table is full The database disk is full and the %s could not be extended. The disk access request size was outside the range supported by the file system It needs to be re-configured to be able to extend the database.The database files are located on a read-only file-system.%s It seems that the NFS server mounting the database disk has attempted to handle the request to extend the database by generating a request to another NFS server, which is not allowed. The NFS server of the database disk has unmounted the database directory. The network connection to the NFS server mounting the database directory has timed out. The server may be down or there is a network problem. GCC: (GNU) 3.4.3 (csl-sol210-3_4-branch+sol_rpath).symtab.strtab.shstrtab.rel.text.data.bss.rodata.str1.1.rodata.str1.4.comment4+ c %, +?H 02??2A3N R4?RWPT 2  ] &>#V)n/8BM [ft~ $(,04#&u@  (( 5 ZA3L*ZDnp)X  8[{@Cf%& (,7H[ah{g 07eCO`kt}   $.9 FPb\Ku&b ; 0DXblvdisknew.c_unameunamestatlstatfstatmknodbatArrayplusArrayminusArraybatIsModifiedblocksReadblocksWrittensyncWriteps_debugps_debug1pTablerPoswPosfdReadfdWriteDataBaseReadDefinitionDataBaseUpdateMapreadPartitionMapPhysicalBaseSizelastPartition_LPartitionNamePartitionSizediskBATwritediskBATreaddiskExtendCloseDataBasetotalNbPartitions_LdiskGetErrorTextdiskBATcompressfuseBatsdiskBatSetd.0isBatcopyBlock.1PartitionAddressCreateOldStyleDataBaseMaperror_text.2_nuname_xstat_lxstat_fxstat_xmknodINITIALDISKSIZEdataBaseCreatemesscrashroutinesimpleCrashRoutine__iobfwriteuArrayReCreate_dbguMessSetErrorOriginuMessCrashdataBaseAccessInituArray_dbguMessFreefprintfsaveAllisWriteAccessblockCheckmessStatuscacheSaveAllbIndexSavelexSaveblockSavesessionRegisterprintfdiskPreparethisSessionuArrayCreate_dbghalloc_dbgmessExitmessdumpeuidseteuidfopenmessSysErrorTextfseekfcloseruidinvokeDebuggerdiskWriteSuperBlockdiskblockwritediskFlushLocalCacheuArrayGetlexDiskKEY2LEX_VBatmessprintflexaddkeyarrayStorediskFuseBatsarrayKilluArrayDestroy_dbgdiskFuseOedipeBatsdiskavailgetenvdiskallocdiskfreediskSetSyncWriteopenswapDatamemcpyswapSuperBlockswapABlockswapBBlocklseekwritediskblockreadreadmesserrorclosestrnew_dbgdbPathMakeFilNamedbPathStrictFilNameaceInCreateFromFileaceInWordaceInCardaceInStepaceInIntstrcpyaceInStreamLinestrcmpunlinkuAceInDestroyhandleHandleCreate_dbgaceInPoserrnogetLoginsprintf 2253M4e5699:;<== =!.8==BOY^=c>?@9===5PW\A}B;C= =#-2=7DNS=X9E9:F>?GHI JK L&1?DMU9mOPPPQ$A+9498:@EQV>]b?p77>?;C>%*?LRXbgRtzASBTUVT"U*0VbWlqRBX<WRYZU0[SXSv}AAAA B 9) 1 ;: ? <R ]] d    A   A 9  9 :  _ # ( >/ 4 ?< L V P[ h r Pw }    A `   A  >  ? 90 = J T d an s M b O  c d b O  c d   e   e   e" 9+ 9/ :4 X ] >d i ?   >  ? 9 9C 9G :` e >l q ?  >  ? 9  _ __",_eeggh h%-hCKhex:HUeqkSOb m(GO9:> ?9:>? 9:#>*/?Klt9:>?9E9:!4LQ>Yhm?>?ATU oZU;WGLRYbgAvAB>?A ;C p7<qCpurst>?TUuWR>WV[RovZUA999: >?)27A]o~WRAAB>? %A3JO;TCku}WRWRx A+p]smt>?>?y999:o=WGLR\umWw|Rz;C9 B(-;2C]ejAz;C9:>?'9+:8=>FK?X_dA|c{|99:zWR<FK=PUqTvU~zZUWR=99 }(49;>CSX^~iBSA 8 F e r ~  9 :     A !!.!9!P![!r!!!!!!!|!!R!!2"J"]"l"q"v"{"|""R""""}""B##'#3#=#E#J#AW##9#T#U####|##V#B##>$W $$?#$W,$1$SD$J$O$U$Cc$s$z$$A$$%"%C5%D%YM%ZR%Uu%}%%A%%%%%}%%R%%>%%?&B#&F&P&n&&9&&&9&:&&&&&}&&&~'''~+'?'Q'V'Rm'w'''''A'''''((5(G(`(r(((R((( ))()A)P)9a)B|)*&*+*5*?*I*N*S*e*j*o*q***q********q***++++*+/+4+q>+H+Q+V+[+m+r+w+q+++q+++q++blocksub.o/ 1133374759 530 202 100644 13336 ` ELF\4( UuUuU u ujU u ujU u ujUuu ujËD$ D$$D$ (D$UWVSEEEE=,t 5,hhj,EutfFEE܃PS5,{t4C9Xt,pPSE4+EPhE [uEu=tstfFEE܃PS5,{t4C9Xt,pPSE4+EPhE [uuEu=totbFEE܃PS5,t|{t4C9Xt,pPSE4+EPhE [uu;5t'uuu5Vh@E E=EPS5,E4$4E4Sh e[^_á%?UVSjh6h8h<hFà th6jPƅt S]h EPE2t_2w 1t3 j=$t E h| j=$t EO h= j=$t E h V Ve[^UWVS }u=@  =@tC  @000)h1hjPE h4hjWƃWjPUKtRBBB2BB=tPIue[^_UjËD$D$+UWVS  Fc[u hrhjh544 E t9{thwhWG54[}u EE9uǃh544X 9} 4P4* G9|e[^_ú ȅt@tB@uIBȅuD$ ȅt@tB@uIBȅuD$ tIBuD$  ȅtyt@tB@uBIȅuD$UVSu VX{ {u+hh4$Ph8K{Ct S SCuBtPCC=tX= u = t xte[^US]S@jSu S]UVSuVEXu VNÉ4$Es{t+hKh4$PhLSCuBtP = t xt CCC=tXExu^8tGVSEPRE9Xt@hkh4$ PVhaCEXp E 8[t@[ue[^US]8;t!hh$d8@8tЋ]UVSu8{tC9XuӃztR9ZtNtB{t[1hhp PVhNu8e[^UVSu8;t!hh$8{u jC8BP8@8e[^US=8t 8E9t!hh$8X@tT 3CCCC=tX[@u]US=8t 8E9t!hh$8{u!hh$SCuBtPtT 3CCCC=tX[@u]UWVS]} 0$V7 SuWu hDh hu PuPu p Pp Pp hT ptb u_GxǃV0U9P t.h(huPhpue[^_USEt<== t't j 5 U=u?tAC j뀃hPh5hTu! hXt ,C j hC {u{t=t%xt=t @CCCCChj3؋]UVSuu~tv~u V4$F^uXtC FF=tp5 = t xtxt^t4{t^FCsދ[u̍e[^UVSu VXu+hh4$PhK{u+hh4$Phe[^UVSuVEX EPVS-K4$e[^USuXt2{t h0hXh|K S]UWVS uE~F(EP6EPvu 6`EB > W<$(t>>FtEC SGG Wvue[^_UWVS ]u E uX9uuEP3EPũ VUe[^_UVSuE: ut( u9pu@ uEPSEP+ue[^UWVS }E7CVuEPWEPu؉؍e[^_UWVS uEEdEt;uztOtntj{u={uB;tu&EP3EPEt U;EtEjjEP[Otue[^_US]U Mu;tDQjS3zBuQRS9u B ] 1#2*31FREEPINNEDUSEDblocksub.cCacheCACHE1CACHE2DISKrwrmcachesizewspecDouble pinning of %sblockload failed key %d %s%s%sblockCheck: bad link at %d in %s list 0x%x -> 0x%x back to 0x%xblockCheck found %d blocks instead of %d %d free, %d used %d pinnedblockCheck: loop found from 0x%x in %s list to %s list - %d'th itemIn semkey.wrm, I cannot read the number after CACHE1In semkey.wrm, I cannot read the number after CACHE2Unbalanced pinning found in blockunpinn %sblockNext called out of contextCant find continuation %d of block %sblockSetNext called out of contextblockSetEnd called out of contextblockSetEmpty called out of contextblock must be pinned to call blockSetEmptySorry, while this program was running another process updated the database. // It is likely that the other process purged the data that you are trying to read. // You must re-run acedb to start with an up-to-date version of the database. // This program will now exit...blockload loaded a wrong block: %x = %s:%s in place of %x = %s:%s blockload loaded a wrong block : %s Error : blockgrab failure(%d). All blocks are pinned. Balance Pinn/Unpinn or Increase CACHE1 which is defined in the configuration file cachesize.wrm.The cache1 is full Do you want write access ?Block grab : the cache1 is full (see wspec/cachesize.wrm) and write access is denied. blockmarking an unloaded key :%s WARNING : blockmarking an unpinned block %s this is not an error, just a delaySorry : blockwrite invoking a pinned block,GCC: (GNU) 3.4.3 (csl-sol210-3_4-branch+sol_rpath).symtab.strtab.shstrtab.rel.text.rel.data.bss.rodata.str1.1.rodata.str1.4.comment4; )( )D % 3@ /@42C2HR4[< , L%a &>$V*n09DQ[ emsy~ $(, $@048U) ,l<$ .Ho:gGNS[bjrz1_ ",<EN.Zelv6p)J Y3 H( tU ajF x;P #0:FLXblocksub.c_unameunamestatlstatfstatmknodBLOCKMAXfreeblockspinnedblocksusedbltopusedblendnpinnednfreenusednc1rnc1wncc1rncc1wtable.0listNames.1cacheSizeOptionsgetCacheSizefirstpass.2blocmax.3blockOrdera.4blockunloadactiveBlockblockgrabblockloadblockisloadkey.5blockfreeblockisunldblockNextKeyblocknewdsk_nuname_xstat_lxstat_fxstat_xmknodMAXKNOWNCACHEblockStatusblockCheckassClearassHandleCreate_dbgassInsertmessoutuAssFindblockMaxdbPathFilNamefilopenuMessFreefreekeyfreenextfreestepfreeintmesserrorINITIALDISKSIZEfreereadfilcloseblockDoInithalloc_dbgmemsetblockInitblockSaveuArrayReCreate_dbguArray_dbgarraySortblockavailblockshowblockunpinnKEY2LEXuMessSetErrorOriginnameuMessCrashinvokeDebuggerblockreallocatelexSetDiskblockpinnblockNextblockGetContinuationblockSetNextblockSetEnddiskfreeblockSetEmptydiskblockreadsessionCheckSuperBlockmessExitclassNameisWriteAccesspickListmessQuerysessionGainWriteAccessblockmarkblockrewriteblockwritediskallocdiskblockwritelexTableReadlex2clearblockfriend_VBatthisSessionBnextkey ,,5-M.e/04 5(AF6q|767)HM6t7787/49>C:Ya;s<=>?>@A>?>%@41>CAM>W?\>d@sB}ACD!&,BJF\dFrGE ?LQJV\KL2bPQRS3DT\ektzTPVWP P( - Q5 R> C SU i o w  T        Q R  S+ U h m Qt y S     Q R  S 1 D I QP U S^ z       Q  S  \  ! * 2 O X l q Qx } S   Q  S  \     > F ^c _o t `  Q R a R a  S^$Q/R8=Sio|bIbcEQ Sb$)d5eOE_d`mu{TTGbTgl|TTTP,1Q9RBGSafQnRw|SPOP73bHk\iijP2PekwPlVHnsopp $,4<objcache.o/ 1133374760 530 202 100644 11808 ` ELF4( UuUuU u ujU u ujU u ujUuu ujUS]t {t6hh uPhh${ u!hh${ ~C ]US]t {t6hh uPh=h${ ]US]t {t6hh uPhMh${ ]US]t {t6hh uPh[h${ u!hh$0{t%hhshdC ]UVSt({tjjScF[~uظe[^VStxtCFx@u tCx@uD$ D$0D$D$ D$$D$ D$$D$([^UVS hLhj55(( t%hPhVF5([uۃh5(5((e[^UWVS ]t {t6hah uPhgh$Z E ljCAtBt!5hihjs UB 7 s UB !hoh$Ee[^_UWVS}W u!hh$^tKC tt&4}uC SC U ؃ SÃu WÃ9;tThh3$ 3PW PWPhq tJC}u SC <$X S C C U  E ؍e[^_UVSur Ã8t-hh3Ph3C CCAtBt#8hh$ VC !hh$؍e[^UVS]t {t6hh uPhh$ 3pK{u 3Ph<C tt5It!B 3$| $# 3 SY $;"t9t{u S2$e[^US] s Ep C U]UWVS}WÉ<$ƃt$ WPh` W^t0{u{t}t Sx) S@à W_É<$X9;tThZh3$ 3PW PWPhq t"C SsC S E  ؍e[^_UVSu] 93tThqh3$ 3PV PVPhq e[^UVS]t {t6hh uPhh$ 3p{ u${ ;hh3 P3Ph 3$t%9t!F~u Vw4$\ 3X${ uCC K{u 3Ph<e[^US]t {t6hh uPhh${ 39XCAtBt%Whh$U} t s $1 s !hh$C]US]t {t6hh uPhh$ 39Xu@ 3tI{ t7{Bu s !hh$ S]USutXtH{u{ t!hh$C S$]US]t {t6h.h uPhh$ S$]UWVSut ~t6hFh uPhh$FAtBtN+hLh$)%whQh$ 5=u5tsF^=u!h_h$#EPt&EPEPEPE;%ދ[tt stlGG떃=  h|h h:0P0$hEhD5ht }E;~tt GG~uYu ~tEJ~uD VK~t&ttEjjV F  Ve[^_US]t {t6hh uPhSh$ SC9u9utBtPCC]US]t {t6hh uPhah$  tXCC]US]t {t6hh uPhlh$SC9 u tBtPCC]UVS=,u"hhjP,,@;hhjPÃ5NtP,P;Ps ,@-hhj5,,@,@$Nu,PP ,;rA'h!h$zC؍e[^UWS]t {t6h,h uPhh$ ,P;Ps ,@-h/hj5,,@,@{te[_áá objcache.cbad cacheNULLcacheMark%s received a %s pointerisCacheModifiedisCacheLockedcacheUnlockcacheCopyCache mismatch %s:%s != %s:%scacheNew: double use of %scacheDestroycacheSavecacheStorecacheDestructIllicit call to cacheKillcachePopcacheKOaddcacheKOadd received A typeBS_cache_limit not setis locked for example cacheKOremovecacheLOaddcacheLOremoveUser stack underflowcacheFreecacheMark called on cache that is not locked.Attempt to unlock cache that is already unlockedAttempt to unlock cache that is still in use, cache->refCount = %dcacheCopy received unknown typeError : cacheCreate called with unknown keycacheNew received Array type, read a.hcacheNew received unknown typeUnbalanced Release of cacheEntry %sSorry, cacheEntry %s is already lockedAttempt to save an unlocked cacheEntry %s:%scacheStore received A class objcacheStore received unknown typecacheDestruct received unknown typecacheKOadd received unknown type or increase the limits in wspec/cachesize.wrmCache 2 is full, %d objetcs are locked balance bsCreate/destroy %s %s %s:%s %sGCC: (GNU) 3.4.3 (csl-sol210-3_4-branch+sol_rpath).symtab.strtab.shstrtab.rel.text.data.bss.rodata.str1.1.rodata.str1.4.comment4 #x %+002?2XN4PW` %  &>$V*n0>L [gw $(, *7 f yn  '5?JRYaiq\l\sH[ '3=KYd[px}0&4Z j 9& o0?H^iyw} $objcache.c_unameunamestatlstatfstatmknodknownCacheTopknownCacheEndlockedCacheTopnKnownCachenAllocatedCachencache1readncache1writtenncache2servedncache2savedknownKeySetfreeStackcacheStorecacheCopycacheAlloccachePopcacheNewcacheKOaddcacheLOaddcacheLOremovecacheDestructcacheKOremovecacheFreeblocSize.0_nuname_xstat_lxstat_fxstat_xmknodREADING_MODELSbsTreeArrayFlushcacheMarkuMessSetErrorOriginuMessCrashisCacheModifiedisCacheLockedcacheUnlockcacheSaveAllcacheStatuscacheKeySetuArrayReCreate_dbguArray_dbgkeySetOrderarraySortarrayCompressarrayCopy_dbgbsTreeCopycacheCreateKEY2LEXnameclassNamepickListbsTreeGetcacheDestroymesserrorlexunlockcacheClonebsTreePrunecacheUpdatelexGetStatusmessoutlexlockcacheCheckcacheSavebsTreeStorelex2clearcacheKillBS_Cache_limitBSstatusstackHandleCreate_dbghalloc_dbgstackExtend_dbginvokeDebuggercacheGetKnownTopcacheGetLockedTopScacheRec %%5&M'e()-.-.05-=FLQV.-.- .$)-05.KP-[`.z%1=Iiqw|56789-$*/4.eo:;-.=-.ot-~>?>?.=8=-G>PU.r@-.A-.-%+05.B=[>diCDDF;4H>=Q>Z_IuJ=->? > ?  .L r w - > ? > ?  .  -     . =' : ? -I >W ?` e .r D = >  C " -* 3 9 > C .Z =  -  .  ; M M  -  .# ( -0 9 ? D I .V =o N F  -  . =  -  .W \ -d m s x } .  -     . -!.,P;@-GL.U[ajP-.QP).-6>E>NU?]bhmr.6;-CLRW\.eqx~-.9>-FOUZ_.nuRS *27T?I[ahm|-.-..>FKTS]lUx~idacedb.o/ 1133374760 530 202 100644 18528 ` ELF+4( UuUuU u ujU u ujU u ujUuu ujUWVS u}hhjjà hhjh/St>u!t t S$hh3VCt؍e[^_US];t 3]ËT$tBUS]tPC}t uuC# u ;C u CЋ]UWVSu]}F 0Su tF}t! h P3t!- h P3tFI}t" 3u F'}u 3u Fe[^_US]U tEPRC puC%hhuC p U]UVSuju VQt0 VnÃjjjhvPSƒЍe[^UVS]uju SjjEPEPVS7  h Puu#hhVh uuEjjjh0su Ѝe[^UVS]uju SjjEPEPVS^  h7PutCv h Puu#hhVhC uEjjjhasu Ѝe[^UVS]uju SC 0EPut h PuuCjjEPEPVS  h Puu#hhVhm uuEjjuh7sujjuhsu Ѝe[^UVSuju Vt~jjEPEPuV' tZ uE4$ ÃjjuhvP<jjShvu$SƒЍe[^UWVS ]u }jVS3EPWSKExt#uWVStCjjEPEPuS+ tlC pEPu uEp uuEus ; uujhsu Ѝe[^_UVS]uju S&EPuS<jjEPEPuSH t9>t4C pEPVtjuEp uu#C uEL uuEus  Vujhsu  Ѝe[^UWVS(]hthjj5ju ut;uE@UB pEPS1 uEu>}G ‹@ x EPB Pt utX h Put hhp PUURj"uuCuV B 9X pOEƉ8EPhPu h Put hhp PUEPj"uuEPuu7u uEPEp utX h Put hhp PUEPj"uu uhhj@ Pƻƒx ~' ЉP4C9Z ىЍe[^_UVS]uEju St>uCEPuSt~ExuCgC pEPVt2 uÃtEPEp S$}t uƒЍe[^US]ju SttjjEPEPuS9 tPEPhPuuE}t uƒЋ]UVS]hhjj5ju S5 EPuSKjjEPEPuSW EPEp ut5hhp PU EPj"uu˃ uEhhj@ Pƻ ƒx ~' ЉP4C9Z ىЍe[^US]Eju SEPuS ExuCijjEPEPuS tEEPEp uuE}t uƒЋ]US]Eju S!t[jjEPEPuSg t7EPjhPuuCUЋ]UVS]ju StqC 0EPuuCH uƃuC& h PVÉ4$ڃЍe[^US]ju SC 0EPuuMCc SEEPh7PSt̓ S uÃu uƒЋ]UWVS }h>hw WU u ÃE Ph7PStu WE PhPSt"u u W\ Vj"Su Se[^_UVS]hQhjj5 ju S]C 0EPuuCru5 h[hj @ Pƻ ƒx ~' ЉP4C 9Z ىЍe[^US]ju StC 0EPuЉЋ]ËD$@ ËD$@ ËD$@ ËD$@ ËD$@ Uhu!hh$UVS]C 0EP @PC pPtʃ uƃt5 h PV4$us E Ce[^UWVS}u EEG ƒx ~UEPЉPt Vt*uhPVEECW 9Z }u:wEPu $ uhPV VEe[^_UWVSu}uE$Eu h^EPjhPSEEPjhPS u hEPjhPSFEPjj!S-u jj!S S uPSuuh,}t3 uPjj!SuuhXtl}u&h$jj!Su ht< v Pjj!Su v Pht5Wjj!Su#Wh hjSu7 8u uuPS8u 8uuuPS Se[^_US]t@=t 5h0hjS j]UWVS } hEPW}?u;;thAuC;vhEhjEPWEE$jj PjjE }t"E4hHuCE+K$juuÃuuShSujuW6 PuuuuyjuW PuuuuFuWÃuW$PSuuuuOuWjPuuÃuuShSuuW@ƃuW2ÃuW$jPSVuuuucuWƃuWÃuWjPSVuuuu_uWÃuWPSuuƉÃuu>t3hSu;u VuW PuuÃuu]ShSuDuWÃuWPSuuƉÃuuP>t3hSu;u VuWQ PuuÃuuShWuvuW PuuÃuu@[u`PhSuuW PuuÃuu3ShSuuWV PuuƉÃuu>t3hSu;utl V^uW PuuÃuuxt,thfuhlu}t u}t# uh<ue[^_USU] t'C4hHR{hsR]Uuthhu PƒUWVS]=u. j$hjjj t;u rEPS5tBED SShPtv5EPSt\ uƃtXEPjhPVt$EPjhPVut VEPS5hhu5ESUShPUBh hjuUBjUB$"hjjjUB EPuEph%huUr à h&hjuuhPC WVlj4$$PVC$PVCWVEPjj"V0 VEe[^_%?4C|K.RMS+8-dgptv0lXuceidacedb.cLiveCreatedscrewup in idKill for %sKilledMerged_intoscrewup in idResurrect for %sResurrectedscrewup in idMerge for %sAcquires_mergeSplit_fromSplit_intoAdd_nameRemove_namePublicPublic_nameName_versionClassNo Class classnowempty obj in updateHistoryVersion_changeacedb-idkill // %s STATUS %s %s %d TRUEFALSETRUE FALSE STATUS BAD_CONNECTION %s_nameId_templateId_nametypeIs_uniqueIs_primaryupdateHistory could not update Name_versionCouldn't add event %s in updateHistory()Couldn't add target %s in updateHistory()Couldn't add dummy target in updateHistory()Couldn't add nameType %s in updateHistory()Couldn't add name %s in updateHistory()updateHistory could not add Version_change? : this list of commands. Multiple commands ';' separated acceptedcreate : returns idresurrect : only if killed, not mergedmerge split : returns idadd_name remove_name get_by_name : returns id listpublic_name : returns nametyped_name : returns name listversion : returns versionlive : returnus TRUE of FALSEultimate : follows Merged_into recursivelychildren : self and all recursive Merged_into and Split_into childrenexists : TRUE or FALSE// ID command expects a subcommand - use ID ? for more help k/sU ZGCC: (GNU) 3.4.3 (csl-sol210-3_4-branch+sol_rpath).symtab.strtab.shstrtab.rel.text.rel.data.bss.rodata.str1.1.rodata.str1.4.rel.rodata.comment4" 8 )# % xE /# 42#C2H%yV)0R F` ^*4(+g- $ 4' &>#V)n/:Z?N/'Zgjbltc~&6 6dS  $/FWalVu[[&/4<E0@NpWcnr v(&N $_  \W*PG(3>'N8]Il{jA# idacedb.c_unameunamestatlstatfstatmknodclassClassidaCurateInitialiseidaFinaliseixCheckgetDomainidChecktypeChecknewIdupdateHistorysetPublicNamea.0a.1addChildrena.2n.3optionsuserID.4nextWordstatusOKdomainDictdomains_nuname_xstat_lxstat_fxstat_xmknodidaConnecthalloc_dbghandleHandleCreate_dbgblockSetFinaliseuMessFreestrnew_dbgidaErrorisWriteAccesssessionGainWriteAccesslexword2keystr2tagbIndexTagbsUpdatebsCreatedictFinduArray_dbgidaCreatenameidaKillbsFindTaguMessSetErrorOriginuMessCrashbsPrunebsDoSaveidaResurrectbsAddTagidaMergeidaSplitbsDoDestroyidaAddNameidaFindlexaddkeybsAddKeyidaRemoveNamebsGetDataidaGetByNameuArrayReCreate_dbgbsGetKeyidaPublicNameidaTypedNamesidaTypedNameidaVersionidaLiveidaUltimateidaChildrenidaExistsidaHistoryidaChangedidaCreateDomainidaSetTemplateidaAddNameTypepickWord2ClassmessprintftimeParsemesserrorbsAddDatabsPushObjbsGotoidUsergetLoginidControlaceInKeyaceOutPrintidErrorStringaceInWorddictCreateuArrayCreate_dbgdictAddbsMark $$5%M&e'( * +,-  .D-012 34# (334X5z67 87 I: 3< = >?@  34 3B = >@ i2x }34 3< = >? @6 P E  :rGHI@ 2KE ? @.  `  j o Mt  2 6/ N>  C 3O 4`  e n 8 N   3 N  3 4  " + 8D Nt E N  3 4   8 N E   $ *3 P :]  2 6, N4 EM :  3 N E :  M N 8NE  *6:CNE: 3K26% *34<>E2E 3NE6: #836O T3^N 3NNE M*2KZ aq*:2a f\k = >]H5 3B @F5N 3I:H 3I@95I N^` e_{ 3K 3`_ 3```#a93CBUZ_n:|`_ `_:`:_`%*_7<_JbR x3I 3I@- .+d08NXft g +c)h g+;9_ gg;AC3DW _gFJ0L_ gg-O gP- 5gN-qR gS   gTA IglU g-V g g,-@-MUg~h g gi .  j #  . k3 W \ 7i  \  ] \  2 6  3 K ! !3!K,!EG!L!lV! _!d!8p!\~! !]!\! !.!j! !k!l! "8" ""./" 4"]="3J"mT"a[" `"3j"<t" y"3"<"b"K"E  $,4<DLT\dlt|  $(,048<@DHLPTX\`dhlptx|  $(,idcurate.o/ 1133374761 530 202 100644 3816 ` ELF4( UuUuU u ujU u ujU u ujUuu ujUuuuu u UuUuU ju uUjuu uUjuu uUjuuu u Ujuu uUjuuuu u Ujuuuu u Uuju uUuuu uUuuu uU uu uUuuu uUuuu uU uu uU uu uU uu uU uu uU uu uUuuu uU uu uUu uU uu uUuuu u%07BPYhuSUCCESSNO_PERMISSIONBAD_CONNECTIONBAD_DOMAINBAD_IDBAD_TARGETBAD_NAME_TYPEBAD_NAMEDUPLICATE_NAMEBAD_PASSWORDUNIMPLEMENTEDDATABASE_ERRORINTEGRITY_ERRORGCC: (GNU) 3.4.3 (csl-sol210-3_4-branch+sol_rpath).symtab.strtab.shstrtab.rel.text.rel.data.bss.rodata.str1.1.comment4? x  )4 % h /42CV4LP    &>$V*n08?GOW4eoz#A\! }!$3@QX`m{ &B[t )3>M] kz#idcurate.c_unameunamestatlstatfstatmknod_nuname_xstat_lxstat_fxstat_xmknodidErrorStringidConnectidaConnectidErroridaErroridErrorTextidCreateidaCreateidKillidaKillidResurrectidaResurrectidMergeidaMergeidSplitidaSplitidAddNameidaAddNameidRemoveNameidaRemoveNameidGetByAnyNameidaGetByNameidGetByTypedNameidFindidaFindidPublicNameidaPublicNameidTypedNamesidaTypedNamesidTypedNameidaTypedNameidVersionidaVersionidLiveidaLiveidUltimateidaUltimateidChildrenidaChildrenidExistsidaExistsidHistoryidaHistoryidChangedidaChangedidCreateDomainidaCreateDomainidSetTemplateidaSetTemplateidAddNameTypeidaAddNameType   5Me8S!t#%''*,.90R2k468:<>@B6D         $ ( , 0 bs2block.o/ 1133374761 530 202 100644 622 ` ELF4(GCC: (GNU) 3.4.3 (csl-sol210-3_4-branch+sol_rpath).symtab.strtab.shstrtab.text.data.bss.comment4!8'8,84l5p T bs2block.cbs2blockDummyadisk.o/ 1133374761 530 202 100644 1068 ` ELF04( UuUuU u ujU u ujU u ujUuu ujGCC: (GNU) 3.4.3 (csl-sol210-3_4-branch+sol_rpath).symtab.strtab.shstrtab.rel.text.data.bss.comment4 0%+049  T &>!V'n-5<DLadisk.c_unameunamestatlstatfstatmknod_nuname_xstat_lxstat_fxstat_xmknod   5 Meacache.o/ 1133374761 530 202 100644 618 ` ELF4(GCC: (GNU) 3.4.3 (csl-sol210-3_4-branch+sol_rpath).symtab.strtab.shstrtab.text.data.bss.comment4!8'8,84l5p T acache.caCacheDummybsubs.o/ 1133374762 530 202 100644 3980 ` ELF`4( UuUuU u ujU u ujU u ujUuu ujS\$ % ‰%  ʉK% ‰%  ʉSK% ‰%  ʉSK % ‰%  ʉS SfC fCSfC fCTfD fDTfD fDA|v[U=t;ffBBfDB{vhhuUWVS}u uWuf@fftY\=t,K% ‰%  ;UtE9Ct fffuf>u^hhuPh.hhuPh e[^_UhWVS\$|$t$fxt0@ǍPP:tBCIufxu[^_UWVS E} uEx t @ 8t] W)fQP;tCB;t Iu;u~e[^_UWVS }u ƍDf_ffU}tfEff9u fEfGVft$fDf9tftfDf9ufu!hh$>fUfTPW e[^_UWVSu} ߍ\f{tCPVf;tPVfCfFff~e[^_UVSuf~u!h5h$XCDffSfe[^UWVSuE ؍\ft<f;tPVǍWf{tCPVTЍe[^_ËL$fAft BfDfuUWVS u }u(Et SE?t=Et9stVhnh7Ph<'hshjjÉpfFfEf;tKTff=t)B щ  J$t SEe[^_bsubs.cBlock error in Bget(%s)Bget called on not old key %sLink list error in BpruneBnew node : block overflowTo see the blocks recompile bsubs.c with #define TESTBSUBSWARNING : bad call to Bnextkey /n %sGCC: (GNU) 3.4.3 (csl-sol210-3_4-branch+sol_rpath).symtab.strtab.shstrtab.rel.text.data.bss.rodata.str1.1.rodata.str1.4.comment4  %+ 02s?2taN4 W    1 &>!V'n-5A{ZIQX`hp{dOM}M"c !!&bsubs.c_unameunamestatlstatfstatmknodBnull.0firstpass.1Bprune2_nuname_xstat_lxstat_fxstat_xmknodswapBBlockBinitmemcpyBgetiskeyoldblockpinnswapDatauMessSetErrorOriginnameuMessCrashBdumpmessoutBnode2strBstr2nodeBnewnodeBpruneBbranchlenBfreelenBnextkeyuMessFreehalloc_dbg 5Me5    !}$? DK P  S&p&)  ) 2*_)bstree.o/ 1133374762 530 202 100644 8936 ` ELFd4( UuUuU u ujU u ujU u ujUuu ujUVSuVu Ép<VEPEPjjEPu9Ãjp54$؍e[^UWVS$E@EEEEjUrkuǃ=];t;us=u jhjjh hhV5hhV5 8u,Ws PsPhEPuE؉EMy|u{~AVFEtJMEtHM܋M9M~}}܉ƃ{t 1hhEpPhdEUPpPEPR M9M~CC@UP@t ){uMy| uuu uue[^_UW=  @ xt&@   B$B xt&@   B$B zwhz tWB 8tO8эA=v R$Uu @9 B@B$ @ xw@ @ @$}US]t C[UWVS]C EhPuƃhhjQǃVP{ uC C 8C 8уy{tCx{tCx{ uƃt~NjCGC;_CGt8SC+BCCt59Xux+9Xux!h?h$}t u e[^_UWVS u] E~ tF EE{ tC E}t}эAƒ}t}эThShjBP}t-uPF 8t 0F }t-uWC 8t 0C ~ uF F 8CFt0CC Se[^_UWVS uE UDEE0]=t*EP% %  EHK]tEf8tuSPu}CExEfxEPuh ]C EX hhj Qh E@ 0]Uf:tuSPuC}tUBtxu PRsEUzwiE@MDEӃ=t'P% %  EHKExu EP<E,]UfztuSBPu CEe[^_UWVSEEsjjPRPƃ txu!hh$}t {u{t!hh$E S4$E8e[^_UWVS(Ex@EWEu}>v Wƃu VtVEPEP!EPVfEut#f}tjEPuEEfxR P9E=}=EPT=t)B ։  r Q VEPEPUfBfEEPRE>v.EUfDfEftaEPRE>wf}tA]{t [{ujSEPuC jEPuE}t V VEPWuE 0Ee[^_UVSuVVEPEPf}tjEPuEfxtu VEPT=t)B Ӊ  ZSEPEPu$ u Ve[^UVS]u S9F~G VhPh SPvu Ph SV=ÍPfxtÍPfxufCffK Ve[^UWVSHu E :t?}։ RE 8EƉU f@f@ M 1 u 6U9B~K Rhrh 6PMquPhD u 6ufBue[^_UWVSuu ǃ=t)F щ  NO~tu vf~w<}EPu V~]u v^f~ u Ã=t)F щ  NO=t)F щ  NK+E fG~t2u vfC~tu vfG+E e[^_UVS]u thS;u9֋9ZuCBCB{tS؋[ Ps{tVs[ue[^UVS]u tH9st'‹sp9XuPPZ{tVs[ue[^bstree.cClass %s, object %s has %d > 100000 cells. This is just a warning, acedb has no hard limits on the mumber of cells per object, but the performance degrades on very large objects, and it possible you should reconsider your models design. In particular, you may be overusing XREF or ?Text. This message is issued once per offending class and per code run Error in bsTreeStore , check bsTreeCellSize() : %slink missing in bsTreeBreakCommentAnomaly bs2 =0 in bsTreeReadCont Anomaly in bs in bsTreeReadCont Overflow in bsTreeStore2 (%s): bs->size = %d, Bfreelen = %d Overflow in bsTreeStoreContinuation (%s): bs->size = %d, Bfreelen = %d GCC: (GNU) 3.4.3 (csl-sol210-3_4-branch+sol_rpath).symtab.strtab.shstrtab.rel.text.data.bss.rodata.str1.1.rodata.str1.4.comment4  %$+@( 02@ ?2LN4 W   &>"V(n.9~LS^dL's %  +! $s\9  '/7BiLU]bn9z %,5?T`jpw bstree.c_unameunamestatlstatfstatmknodbsTreeReadbsUnpackTimeStampswarn.0bsPackTimeStampsbsTreeCellSizebsTreeFindBlockbsTreeStoreContinuationbsTreeStore2bsTreeCellSize2bsxxxsizexxxbsTreeBreakCommentbsTreeUnbreakCommentBSbufferbsTreeReadContbsTreeSt2_nuname_xstat_lxstat_fxstat_xmknodbsTreeTESTbsTreeGetiskeyoldBSallocBgetblockunpinnbsTreeStoreuArrayCreate_dbguArray_dbgnameclassNamemessdumpuMessSetErrorOriginuMessCrashblockSetEndblockrewriteuLinesTextuPopLinehalloc_dbgstrcpyBTallocuMessFreestrcatBSfreeswapDataBnode2strblockGetContinuationblockfriendblockpinnBinitBpruneBfreelenBbranchlenblockreallocatebsTreeKillblockSetEmptylexkillbsTreeDumpbsTreePruneblockSetNextBnewnodeBstr2node_VUserSession 5M e!"%&'(Vcq*v++,-.af/t,}0&&124@LZdlu}"3;Ca34567 4.&/08DO5i9~8987:#&1;<756;) =U Z /a f 0  /  0 : : % > %* '< ?M @m A B ; ( ' CG C A 2 ( D @ % '0 AF (Z ; ' 1 2 F G B H  / B% ,. 3 0w I J @ @ BH!/+B@,IN0rIK;L?KJ;;,Mb:&bstools.o/ 1133374763 530 202 100644 4784 ` ELF$4( UuUuU u ujU u ujU u ujUuu ujUWS=u8 98jEhjP@;;}!סy;~%y=jPhjPÃOtMP;Ps @*jRhj5@@$OuPP ;rA$jUh$  @ ;~ ؍e[_US]{ t s P;Ps @*jbhj5@@ H ;} ]Ë D$D$T$ UVS=uj|hjP@;j~hjPÃ5NtPP;Ps @-hhj5@@NuPP ;rA'hh$ C؍e[^US];t 3P;Ps @-hhj5@@ ]ËD$D$T$ US]t.{t9[t s؋[ Puҋ]US]t\;tG9Xu @19Xu @!hh$t SX]UWVS ]EE }U E{ tAUB S JHC 8t!Ep hhjC 0{tusqUB[tEE UBEgEe[^_UUtjR UVS]t {t sƃF[ue[^UVSutv \th j Kuvv6v$vVh$h ~t v vue[^bstools.cUser stack underflowdouble link error in bsTreePrune%8lx : k.%d(%s) up.%lx down.%lx right.%lx GCC: (GNU) 3.4.3 (csl-sol210-3_4-branch+sol_rpath).symtab.strtab.shstrtab.rel.text.data.bss.rodata.str1.1.rodata.str1.4.comment4  %+$$02$?2DRN4W `  <  &>#V)n/; CLWcktA; /CNUt\*e-mwd'o" =]bstools.c_unameunamestatlstatfstatmknodfreeBSstacknBSusednBSallocblocSize.0freeBTstacknBTusednBTallocblocSize.1bsTreePrune2bsDoTreeCopydepth.2_nuname_xstat_lxstat_fxstat_xmknodBS_Cache_is_FullBS_Cache_limitBSallocMAXKNOWNCACHEstackHandleCreate_dbghalloc_dbgstackExtend_dbguMessSetErrorOriginuMessCrashBSfreeBTfreeBSstatusBTallocuMessFreeBTstatusbsTreePrunestrnew_dbgbsTreeCopybsTreeSizebsTreeDump__iobfputcnamefprintf 5Me!" *1?#O^ksx$%&,(4CPX]$eox~" # +:JRW$_i{%&+"2:?$GQ[fr}' %&H v*. C0j{234251keyset.o/ 1133374763 530 202 100644 4000 ` ELF4( UuUuU u ujU u ujU u ujUuu ujËL$D$;w ;JUWVS(u} EEEj?hjjj E tuEt~u t$tjEh$E9F E9G ]^MO; u.jKhuEuMNE E(EGUVPRyEEE9F ~E9G Ee[^_UWVS}u u%u j^hjjj tu t$~tjah$ujehjVujkhjW johjjj EEEE  ~ ]_MN; u.juhuEuMOE EtEFUWPRy+jzhuEuMOE )j|huEuMNE E9G ~ E9F 0E9G u>E9F ~zhhuEuMNE E9F DE9F uE9F ~zhhuEuMNE E9F DE9F u"V(n.6=EMUa!k|E8Fkeyset.c_unameunamestatlstatfstatmknod_nuname_xstat_lxstat_fxstat_xmknodkeySetOrderkeySetANDuArrayCreate_dbguMessSetErrorOriginuMessCrashuArray_dbgkeySetORarrayCopy_dbgkeySetXORkeySetMINUS 5Me   [ i  # (6 >Q Yk v  "? M  C Nw |    8I Ww    r }    Rc q bsdumps.o/ 1133374764 530 202 100644 6568 ` ELF 4( UuUuU u ujU u ujU u ujUuu ujUEpUWVS}Exu =UB;t;u =_ P;Psu2 @-jahj5  @}8 @E PuEPPxtX} t,E xt#HAt9Au ЃUB"u~u~v{u{w}O juuu PS 2EH=} E x@P; RE]ыULM9v9;tM܋u9uv }܀?;uE܀8;uEܺ Eܹ։8EEH U;t#S But9t;UtփhE}tPsE}uujjEu~ hhuu}ua SǃtO}ujSPt* jE@PuwPGp WEE}9G m}thhu 5 @;QQ ;rA'hh$P;Ps @-hhj5@@ A;c 5@;QQ ;rA'hh$ P;Ps  @-hhj5  @ @C;u=h+5s$P5{t=h05s$P5k{u'sh2P5>{u*C$h6P5{u5h05sP5{wSh05t{ t C 8tPP5z=uCtkt7 sP5h:50h05sP5=t>{t8h<5s$P5 A;% A;vVhAQhhj5PhCutPhF PP ;s!hh$}uURUVe[^_UWVS ]=t[ hWt Pu P hct hhj@5h hj@5 h hj@5}u2Cp S$$ju PV: Vs{9t`=u C;tKP;Ps @-h#hj5@@K{u{w ;t뇡@;QQ ;rA'h-h$ P;Ps  @-h.hj5  @ @ A;c 5$ju WV e[^_bsdumps.cWHOLEIS *User stack underflow -C %d %f -O %sdump error : %s ACEDB_BREAKACEDB_DUMP_ATTACHGCC: (GNU) 3.4.3 (csl-sol210-3_4-branch+sol_rpath).symtab.strtab.shstrtab.rel.text.data.bss.rodata.str1.1.comment4  % + 02 u?} 4 H   LL &>#V)n/5A Rco}*27@U_jsdg").@bsdumps.c_unameunamestatlstatfstatmknodBREAKdumpQueriesaceDumpWorkStackaceDumpTempStackaceDumpTextbsAceDumpCelldumpCellKeyisFirst.0_nuname_xstat_lxstat_fxstat_xmknoddumpTimeStampsdumpCommentsbsDumpbsTreeDump_VComment_VUserSessionstackExtend_dbgbsModelMatchbsModelRight_VQuerynamepickListqueryKeyParametrizedqueryFinduArray_dbgbsCreatebsDoDestroyuArrayDestroy_dbgstackClearuMessSetErrorOriginuMessCrashcatTextfreeprotectmessprintftimeShowstackText_dbgaceOutPrintmessSysErrorTextmesserrorbsAceDumpgetenvatoistackReCreate_dbgbsModelRoot 5Me  !.A!"# $o%& '4?(S)n'"*+,).-5:.HWgot |,-..6; CM[ekp/{$0//$0/1/#1-2/HNS/^2hm//0/$/ / &+/6$@E/N_ej/u$}0//3456 -2-9>.r}898: :   " :' . F ;N "{           ' , -3 8 .F U e m r  z     ,nicedump.o/ 1133374765 530 202 100644 16696 ` ELFD&4( UuUuU u ujU u ujU u ujUuu ujUWVS,u ]CEԅhEPV.U)ډtg tSEl}&}GjWu|݅y؈EjEPu.E]ԃ~wVEtjURut~ t F 8tQRu~u4FEEijURu jEPu~u4FEEfjEPu jEPum~u4FEEdjURu jEPu3 v vǃt8EtjEPu QRuEKFEjURuvƒ QRu~tIEkFEjURuvƒ QRu5F~u,EEgjURu jEPu~t|EPBt 9BujhuSu PvuËEPBt 9Bujhuvtjhu؍e[^_UWVSh+uh-u 6ENUFB jRu QSuFxt"jv PFpu!E#jEPug FpEE}xE܀}xt}Xu EE}yE}YE؃= tEPEPFPFP EPEPEPEPv4 PhuFxt>huuujjEPv PFpu 0uhu}t uEhu'hh EPhe[^_UWVS } m=uU B;@ E pEu u 9EE}e x+EEEuuuuÃt~ǰt ߉IMEEx~ Fx+EEVFuSu5VFEPSu߰ك;Mv ߉ىM uÃuUUEyEE xtuupuE;u~uU RU Ee[^_UE= t pxwtx t @ 8td]xuph0Bxu @$h3$xu p pUWVS Ut8tA Rƃt/jSPt vǃ Ve[^_UWVSu} EPu ;u}h6uC;]|u uu  PhuE xt9u uE@Puu PU ru\E =}Ex@P; RE] эLM9v9;tM܋U9Uv u܀>;u}܀?;uEܺ8Eܹ։8E E;t#S But9t;UtփhE}t>PsE}uujjEUz hh uu04$Ãte}ujVPt4u uE@Pus PCpuE S E}u9~ a}thh uE @E thu;MEe[^_UWVS u] } =uh8h jh 5uhC5= t]FE;tKR5v$PhOP5~w}= t F; t TuZP5 t~ t F 8tPPhOP5!~uY= t = t ^ucP5vhgP5~u\= t = t lusP5F$hyP5`~uy= t = t ~uP5tvvPhOP5~u]= t =thK5 v$PhOP5~= tV9t3 v$PhP5 v$PhOP5=t7~t1=t F;t vP5F Fhnh j5e[^_UWVS,E Eu$u} EPu ];]}huC;]|E= tEPuEPE P EPEPEPuu - Phu=u%}tExt@@E;tEE xu}thuE xt5uuE@Pjuu PE pu } E@pE] ыELM9v9;tMԋu9uv EԀ8;uuԀ>;uEԸ8}Թ8E؋ =;t"S But9t9t׃hE}t>PsE܃}uujjE܃x hh Wu04$Ãta}ujVPt0uuE@Pjus PCpu7 S Gu9~ l}thh uE xu}t!];]}huC;]|uhuhu}t uEE ;Et!}t uEu uE$EE @E ee[^_UWVS]u }EEEEEEE{wVEt{ tC 8tEEEZUU@PE0hjE܃{uOEsh0jEEEcE@PU2hjE܃ U{uSECd$$h3jEEEsE@PE0hjE܃ {uEE sEEE@PU2hjE܃ C{tA PEsEEEE PhjUgC{u0 PEEKE PhjU.hTh sPh,>tEuP~t }uP~tEuP~t }uP~ t }uP~ tE܅uP~ t }uP~uPE~uP~uPuhÃ,uhjU}t u}t u؍e[^_UWVS(EEU EEEs{(u2E[ uEPSUEU  sƃhcPuEhsVuE h-VuE6hh;VuE@ECEa;uyEE{tgCx)u^ j)[uEPS[uEPSsEEEU e}utW}uPEuP}uPRuVhà h?uPhjU؍e[^_US]= t s{w:5t{ t C 8tP5h{ush{u C$hs{u-5s P5h@ s s?tX5P55sP55s P5h05sP55s P5h wC{u(5P P5hF5sP55s P5h  ]UWVS}  EPu ];]}h6uC;]|h!uu PhuE xtNh#uE@$ju PU ruLh+u=}Ex@P; RE] эLM9v9;tMU9Uv u>;u}?;uE8E։8E܋ E;t#S But9t;UtփhE}t>PsE}uujjEUz hDh uuE$Ãt|}ujuPtIh#uE@$js PCpumh+u S E}u9~ G}thTh uh+uE @E th-ue[^_!@ ACEQMnicedump.c%s %s%s{,Pn=>[ ]} %d%g WHOLEIS *?Modeltag?%s?#Texttxt#Intint?%d?#Floatfloat?%g?#Datedate Txt%s-%dIntFloatDateobject_ref" value=" level=" type="<%s%s%s%s%s%s%s%s%s%s>%sINTFLOATdatetypeDATEtextTEXTTag maxOccurs="1" maxOccurs="unbounded" xref="%s%sty=>tx,va=>%s%s%sty=>in,va=>%dty=>fl,va=>%gty=>dt,va=>%s%s%sty=>ob,cl=>%s%s%s,va=>%s%s%sty=>tg,va=>%s%s%s}, Logic error: unknown style %c in niceDumplogic error, unexpected type of tag/class, class was: %s.%sty=>ob,cl=>%s%s%s,va=>%s%s%s,ti=>%s%s%sty=>ob,cl=>%s%s%s,va=>%s%s%s,mt=>1XXXXaGCC: (GNU) 3.4.3 (csl-sol210-3_4-branch+sol_rpath).symtab.strtab.shstrtab.rel.text.data.bss.rodata.str1.1.rodata.str1.4.rel.rodata.comment45! 0 %l!+p!$02p!0?2#/R$N ? Z%4%cL(@ $ -D &>$V*n039A) ~PZ c q}  (-Xk  .6=EMUbouz&1:CLYem{#+9nicedump.c_unameunamestatlstatfstatmknodqmdebugniceBSCniceExpandTextisFirst.0isModeleniceTextUsualniceBShumanniceTextJavaniceBSJavaniceTextPerlniceBSPerlniceTextXMLSchemaniceTextXMLniceBSXMLattachRecursionLevel.1old.2oldTime.3s.4attachRecursionLevel.5attachRecursionLevel.6_nuname_xstat_lxstat_fxstat_xmknodbsModelMatchaceOutBinaryiskeynamebsModelRightniceDumpgetenvhalloc_dbg_VModelisModelclassNameaceOutPrintaceOutxyuMessFreeuMessSetErrorOriginuMessCrashdumpComments_VCommentuLinesTextuNextLinemessprintftimeShowpickListbsCreatebsGetKeyTagsbsDoDestroy_VQuery_VUserSessionqueryKeyParametrizedqueryFinduArray_dbguArrayDestroy_dbgstackHandleCreate_dbgstackClearpushTextcatTextfreejavaprotecttimeShowJavadumpTimeStampsstackText_dbghprintfnameWithClassstrcasecmp $$5%M&e'()**E*~******,*?+t***,**,-*S*d* *- * *,7 </AR [0`hu123 4D L5 4M U4e m4 4 4- 4 4,*9*R-|*3, 44H P4i- 46 4 78 9 :{ ; < 5 5 <  ,  =  = > ,O ?a @v A B )  4  45 -X  C ,  : D. ?F  T  ] Ex F  G @  F -B!I QHi q4 IJ K+ 118 ?DLO,WM` e=otL  LM =L  ( /4LB G=QVLjs~  L =L  L >N# (=27LKT_ ejLx,M =L3M =L,M  =L&O5AN,X]Lhpz P) 43 ;4DjC 4-,= a:gD?  EF G@'FI-gBm H 4 4 46%6   Q  Q! ( 8 ?QW f mQz   Q >   Q3, ' .QJ,T ` gQ~ 738         ' 2 8 C R X c l q=~ Q66 R-$)?,I OS] b o uS   S  S   1 ,-')5-B)M,ej u {     =    Q ,@E J=c h= => =+,)338==NY,cit3~ =, =,3=+)> F4W _4s {4 4- 4 C,g :D?  EF$  / G< @K _ Fn  v 4 -  4 B   H  !4! !!4  $(,048<@DHLPTX\`dhlptx|asubs.o/ 1133374765 530 202 100644 11852 ` ELF4( UuUuU u ujU u ujU u ujUuu ujËD$D$S\$ % ‰%  ʉK% ‰%  ʉSK% ‰%  ʉSK % ‰%  ʉS K% ‰%  ʉSK% ‰%  ʉSK% ‰%  ʉS[UWVS U BU „ƒa$Gt GuEx ~2 % ‰%  ʉUZF9r ΃xjph$Xt GuEx ~2 % ‰%  ʉUZF9r ΃U BU „e[^_UWVS EE}u!hh$(?awi$XEzElE^EPEBE4E&hh WuhX;u~uؙt Cؙu]G?>ؙ}t Cؙ}u؍e[^_UWVS } tE xu xt}u!hh$EU z uj EU B2}?aE$t Fuujjh7t Fu 6 Phut Fu SPS Phuhh$t Fu6h"ujt Fud$$h'u;uPF&hh VuhG?|EUE 9P @uj uj e[^_UWVS] EuE AuwA}tu!hh$ u9tqhhuu PShD =hhu PuPhx=tjjju uWEPuE8Pt9h h E@PuPht=E9Xt5hhSEpuPh hhuEppƋE@F EXVN$QPRߍE$uʃ u9~ t.hhuPh}tuVЍe[^_Ujuu uUWVSE} tE xu xtx E uE AuzEA}u!h>h$( uU 9Btvh@huu PM qhD =hDhu PuPh\jj=tjuT=tuu EPuM qƃEUP EMHE PEPM Q EPU9BɋE PUUPM$uRQ9}&)ڋM QAE$RjP])t EPV uu=tuu =tjujuju ue[^_US]<t S St#EPSu$jSjS=tj)S]USu At8hh$ PSPh S ]UVSu t~u>txuxu!hh$~u!hh$ VC h,6ue[^UVS] Sh,juƃ~t!hh$hhSj Ã8thh03F CC FCC؍e[^UjuUWVS(]uE At=hhu PuPh$u!hh$X SU 9Bt3hhSS PE phD } t:U zu.zt(}t"Exu8txuxu!hh$E x PU uE$hjjjE hhjP8hhjuU hhjuUt=t+Su =th.uEpp U BB u hhjjVEUB BP2SUB@} WE 0SU u0S]E+X 9t!hh$h,uu}thhu}thhue[^_UWVS(u At8hh$ PSPh}u!hh$ h,jSE}= hhjjj@ E0G@PV7G@ƃ=th.Wh%hjWEh%hjW h%hjWEu9t2h(huu PShD h.huSuEUP ڃSV0ރ=tuuh4huj Ã8th5h0 h6hujuUSS PSCUP uV0uU+9B t!h=h$0}th>huth?hWE UEe[^_asubs.c bsunit %s %s : "%s" %d %f ckarrayStackGet internal errorswapArray : Cannot byte swap a pointersizeOfFormattedArray received a null pointerUnknown format %s at %s in sizeOfFormattedArraynull a or f in dumpFormattedArraydumpFormattedArray tries to dump a pointerUnknown format %s at %s in dumpFormattedArrayFormat strings are no linger optional in calls to arrayGetActual size of array %d != size %d of format %sAttempt to arrayGet a non-array key %s:%sarrayGet(%s) read a block of h.type %carrayGet(%s) read an array of incorrect size %d != %dSize inconsistency in arrayGet (%s)Format string not provided in call to arrayStoreAttempt to arrayStore a non-array key %s:%sAttempt to arrayKill a non-array key %s:%sstackStore received a non initialised stackstackStore got non text only stackstackGet read a non char arrayAttempt to arrayStackStore a non-array key %s:%sFormat string not provided in call to arrayStackStore arrayStackStore received a non valid array or stackarrayStackStore internal errorAttempt to arrayStackHandleGet a non-array key %s:%sFormat string not provided in call to arrayStackHandleGetvV[Mwi[aGCC: (GNU) 3.4.3 (csl-sol210-3_4-branch+sol_rpath).symtab.strtab.shstrtab.rel.text.data.bss.rodata.str1.1.rodata.str1.4.rel.rodata.comment4 # %8+8028M?2ZRN <, Z4 c`    &>!V'n-4>  JRYaiqy*3Fb&/>GQbis D o $ /9P H^pyasubs.c_unameunamestatlstatfstatmknodnareadnawrittenarrayDoKill_nuname_xstat_lxstat_fxstat_xmknodaStatusswapABlockswapArrayuMessSetErrorOriginuMessCrashsizeOfFormattedArraydumpFormattedArrayfputcfwritetimeShowfprintfnameclassNameuArrayHandleGetswapDatalexAliasOfpickListexternalServeriskeyoldblockpinnuArrayCreate_dbgmemcpyblockNextblockunpinnuArrayGetarrayStoresessionAutoSaveexternalSavermemsetblockSetNextblockSetEndblockrewritelexUnsetStatuslexSetStatusarrayKillkillFuncblockSetEmptylexkillstackStorestackMarkstackHandleGetstackHandleCreate_dbguArrayDestroy_dbgstackGetarrayStackStoreuArray_dbgarrayStackHandleGet 5Me\ ahm &+I L QX]   !4"A#J R!j ov{ ! ! ANy%&'     %0"?#HMV(h(v)* " " 0 A+q,~-. "$C &X 'r  w ~           " #   $ 1- 2> 2O %` r * , 3) 4< 5G 6P %a j 2{ 2 7 8 9 : ) * ; < 8 8) 28 2O &c 's  x  " #           - >8  B 0Z  d $      @  A?'&<'L Q\"k#ty  5 :AF`>o z+ D D D%% * 4+O,m,,  0 A A &4'D IQ"^#gl  / +,% " *D9 ADP XDh|  +,% @ #A9 F+{,   A A  $(,048<@DHLPTX\`dhlptx|bssubs.o/ 1133374766 530 202 100644 36640 ` ELF`W4( UuUuU u ujU u ujU u ujUuu ujá+T$++ T$UWS=(u:hhj$hhPP( (@;hh5$PRÃ=OtP(P;Ps (@-hhj5((@(@,Ou0(PP (;rA'hh$  ,Cd؍e[_US]{dC{ t s C {(t s(C((P;Ps (@-hhj5((@(@ ,!hh$]Ë,D$0D$D$U=$t 5$$ËD$t xdtËUWVS u]VE7GdE GEG ___Vuc=t&hhE%P58u uhhE%P5GG G$jje[^_US]t} Bud SÃ=tjjjP Su'jEPS uPSƒЋ]USu BuV=tjjjS Su'jEPS uPSƒЋ]UVSu# V Bt8h?h4$ PVPh Vt*=u!hCh$$=t> V@t Vuj@VjjjVu EPVÃt,=t SVuSVe[^UjuUWVS u} G9t!hjh$d V Bt8hoh4$ PVPhjEPVÃt&EPSwEp uSVe[^_UVS]Í Bt#hhShjEPVtuPVYƒЍe[^UVS]StztJAt 9At}BpƉC CC=t%hh%P58u Vhh%P5Ce[^US]tR{dt-hh3Ph s$]UVS]t~3=tjVjS Sjj!SuK$ S  =tjVe[^UVS]u C$u S {dt-hh3Ph{u!hh$jjC;Pt?hhCp P3PhL=tuj3=ts3S3sj3Cxt: 3taj3C$C$8 3u'j3C$C$=tuj3{ ts 3 5 Sle[^UjuUVSu] ~dt!hKh$p!t!!w "FXt3C;t;u [t C9t9t vEtuWEPS^EF7h[h$jSVE0e[^UVS]u Et<VSt+ SÃtEPVS$Ee[^UVS]u Ehhjj 588 VS SÃtpEPVStO54S4 EPj!Su%54S EPj"Su SEe[^UWVS ]u t^1vYuPVSƒtr4t-) SÃtVPlj$e[^_UWVS uU }^FE!t!w tS""t[ uE4[/jRV#.t|FX vE}tZtQC;t>;t6ut.}tCUEPS^EF [uЍe[^_Ujuu uUjuu uS\$St Bt; t; uu[UWVS]}uu Sti`Vj!StH5<S<jWj!S u5<S Vj"SuЍe[^_UWVS }]jEPu W 9]tujVj"W9]u}t#wt 7t"0G@UG@UG@Uwd(uh7hjG(h8hw(tGx t @ 8tPU(&h;h$1Ѝe[^_UVS]ujEPu S{(uhVhjC(Et3wt utFnCphIs(C@d$$hLs(hbhs(jSrPb}w:hhhs({tCx t @ 8tP"hjhs(u$Ѝe[^UWVS }]t{u{u#h~hSh{t!hh$C u WtSuWtfe[^_UWVS ]EE!E}tExuxu%hhuhDUzt!hh$pE@ {dt!hh$Os~uUB _ hhju 5DDU P hhjR5HHU P }!uFF!P;;ơDP4~u~vHHF Ft(wt Ft,?HHF ~HHF iHHF T~w-HHt~ t V :t!hh$gGEE! @t ;} }hhEEE HPu@EHE UB 9}}HPC9|C;E }C;E |OE}"uOxDP4E"Ex e[^_US]hhLp PS{t s{t s]USUt& Bu RÃuY hhjjj LsF$h5L5LL]UWVS]Ehhjjj ƍ BPÃ=t#hh%P58u Shh%P5 hhWGVUjEPSuЃhV4$Ѝe[^_UWVS Uu  BufPPÃtAP JtA9tJuth9hSȍe[^_UVSEM utX ( BQút|=t%hNh%P58u SFv5jVhVh%P5 0ƒЍe[^UE Buu RjUWVS} ]usuYC;tMtI vt6hmhEp PVhnhw WS {t* S9tSS PWuX{tjsWuAe[^_UWVS]hzhjjj Eh{hjjj ǃ P%ƍ Bui=t%hh%P58u Vj hhS5pWupE UE8e[^_US]t{{dt-hh3Ph su" 3Phju S2 ]ËD$t xt@@øUEtxt@xt pUEHU QH$pUWVS } }Exdt0hhU2Ph!!w t"MAM9HEu!hh$4EMQR9t!hh$\UB;Bu0hhM1PhUBE@;z uhhjj@MA UB P;PsMA@A @5hhjEp UB PMA@A @UB P;PsE@% MA @?hhjEp UB PE@% MA @UB P;PsM UB @/hhjMq UB @MB @UB P;PsE@%MA @:hhjEp UB PE@%MA @UBMHZCEH$ p~Ur^BEvWuQ!Mq^ qEu7 E0 PuPhtU9Sދ["uEMAEAEPQuB U2 PuPhujExteP;uURuuB M1 PuPhuE@=tE,Ex uh#hjj@UB MA P;PsEA @/h$hjUr MA @UA @MA P;PsE@%A @:h%hjEp UB PE@%MA @E@"9pu 9Xt3!thC;t;u ދ["D9^uCFCF{tC0CuSu "u^^uE0!u(F)EPSUZEB/MNUEPEMAI$ qЍe[^_UWVS ] }} ExdhShU2Ph,Ep9~bt5w tFU;~EـE@uFE@FۀE@FE@ EFU;usw3t~ t F 8tuPu6huh$}؃ tlUB@tC~tpvRF~t;EpvPgF"WSuBUrt wt .t'UFUFUFwy~ u F F 8t 0F ^ hhj}QuF 01OظFhh$EH$F Ure[^_UWVS }EENdt-hh7PhX} tE 8u _{C@;t ; CpPu [{t\C@;t;uE CpPu -[{tC@;t;tF}Cu5FPu 'hhEPh uhhjj@G G P;PsFG @)hhjw G PFG @G P;Ps<G @*hhjw G @<G @9_uCFs5CFs~tF0wGO$ wЍe[^_UWVSu] }؃"u PVw7PSV"wWPSV7SVe[^_UWVS }}tExuxu%hhuhUzt!h h$}tE9E}!h h$} "w<hh} tu Ph@u W Wu W5PWPEUz EUBS}"PW8tn5PWP;u}Sj!Wt7F;u|5PWEEEU9B p$u Wt WЍe[^_UVSu] u!h7hujC );C t!h;h$FCFCFC F C؍e[^U ju uUUtrRhUVSu] tC;C t!hPh$CFCFC FCF 8FFF6F $Zh%P5Fe[^UVSu] C;~ uhjhjj@F F P;PsCF @)hkhjv F PCF @F P;Ps<F @hlhjv F @<F @}EPSE@~ uhrhjj@F F P;PsCF @)hshjv F PCF @F P;PsE@% F @6hthjv F PE@% F @{tusV4{t.}tEpsVjsV Se[^UVS]{dt-hh3PhdKst9KuX9JuABABytQAVQSSjSK$se[^UVSu~dt-hh6Phhhj 5TT^{u*;t%9Xu;Ft{u;t 9Xu;Fu9^t`TP;Ps T@-hhj5TT@T@9Xu Ӌ9Zt9^uhh6%$5ET@;QQ T;rA'hh$  uEC;t;u EcEPSu<hh6 PsPh TA;,^EF Ve[^UWVS uhhjh,Ehhjh,ǃ hhjh,EjuÃVP$4$$4$4$juÃu P$ u Pu PhPWhWhhjuƒ B< uRWhWhWhhjuPWhWhW}t u}t ujjh(hjWPÃt W؍e[^_UWVS }=uC hDhjjhhEhjjh E Bt!hKh$hOhW5 8t(hPhW5 01hRhjhRhW5  hThW58t&hUhW50;=u.h]hW5C* uƃxt @xu8hghhu Phh vhkhW5V=Xu hohjjjX \=`jhshW5phshW5 0e[^_US]tL{t9[t s{t9[t sCC S]UVS= t p t NtlEE;tPEthhPEPEP3uʃ;t 3Nu= t%hh5  =Xt%hh5XX=tp t Nt 3cNu=t%hh5e[^UWVS ] {(ރ{tBhh5` PpPh\;t9XtBhh5` PpPh^l~t~9puXX VE{tusut؃{t @xuxhh5\5XS\@\hhP5Xs {uxvs*tnhhj5XPVuu@hh5` PsPh"C{tkCx)ubNjpu1hh5`PhFCFCt V<$&C=%,tC<{t^Cx-u!K@Ct R{t.SJ;uKBCt R}tK{t!Cx,u[jsu \e[^_UWVS } EPÉƁ=t#hh%P58u ShhV5 tw j9w3hhhj PWh8 EPWSth!hjuƒЍe[^_UWVS] Ep h0hV5 8URUEE_ j9w3h;hhlj PSh EPSW hBhV58EUPEE܅ WEEpt=F;t;u)E uvt F9t9tt+U9QuM9WE9GuIuՃ}'t4Gt.9pu @ @WVuCU܉SE9WtBt3Q;t;Wu ItQ;t;WtE9Gu;tBCZ{t&CstU}tZEX]EUPEE܅pUzEB}tJ$ rЍe[^_UVSu EX!t!w t<"u [0[+hh4$PhtG[;u5 S@$Ɖ$8#u ƒЍe[^UWVSju U B ‹M ;A$ЍRM Q zA XjWAƃEEt(ju%PVt% Vu%PV=tvWF$u EFEjV}tF u6 WPW PuPh M Q ;Qe[^_UWVS u FtExuxwUJ]{ uC UB p VW]Ct V9:E@EUz u ]C E@EuߋURUtXB;t;u% ][]t+C9t9t}tE Vƃv]tGC;Ftt/F9u'VS~u ~Fߋ[uPЃAFAFt9FuЃAAt&S;Vt;PttF9tutCAKytAUQt MFt 9Ft VQv]{trC@;t;u[E@ExtA@@;t;u* ][]{tC@9t9tUEP E]C}t]Ue[^_UWVS ] s0E39^u E/9^u E!h{ h$? SÃ=t%h h%P58u Wh h%P50Sf}tCFCFC0 Se[^_UVSu6(Ã=t#h h%P58u Sh h%P50ve[^USUtf2蚼Ã=t#h h%P58u Sh h%P5]UVS]tG3ƃ=t#h h%P58u VCe[^USURJt{9uqQ蛻Ã=t#h h%P58u Sh h%P5tPЋ]ËT$tBVSt$D$ @tt:u@9Zt69Pu ʋ 9Qttz*t9Zu  Ru[^ËT$tBUVS]xE PS\E @/@t tX=ttC;l}=tC;lCpCx|C=tt!Cdt#=tCdEChSٕtd$$h[V tPhaVtCx|C1h% hE pPhP{t u Ps~[e[^US]E ujSPSEE@C;Cuj!SxEdEhEu!}fE fEm]mE}fE fEm]mElEEEum]mEm]mEp|Etss:=xtK$ s]US]E PSE @t_xu(C;tKCx|C1h[ hE pPhx{t u Ps\[X]US ]jSj!SxE |ss=xtK$ s]bssubs.cUser stack underflowBad obj in OBJfreeWrong type in bsGetData%d%gbsFlatten got a bad objBad type in bsFlattenUnknown type in bsAddDataWrong type in bsAddDatazeroBad mark in bsMark(NULL mark)%lx ->curr=%lxBad mark in bsGoto%s : "%s" Missing model of class%s: %s %sDuplicate tag %s in model %shook error in bsSubFuseType%1.7g%fbsUpdate called on non B key %s:%sErroneous attempt to update a model object!!!!!! Seek help now!Attempt to clone into object of different class in bsClonebsGhost called on non B key %sbsDoDestroy received a non magic B obj (%s)bsDoSave2 received a non magic B obj (%s)bsDoSave2 says : Jean owes a beer to Richardkey mismatch in objStore %s != %sbsFindTag called with null or bad objectbsFindTag called on bsDown, the result cannot be guaranteedbsgetArray received a non existing array %dbsgetArray received an array of wrong type (should be BSunit)bsFlatten received a non existing array %dbsFlatten received an array of wrong type (should be BSunit)bsAddTag received a non magic B obj (%s)bsAddTag fails because %s is not locked bsAddKey received a non magic B obj (%s)bsAddKey(bsHere) is forbidden for a tagtype mismatch in bsAddKey(bsHere)bsAddKey(bsHere) at root of %sTrying to add %s off end of model for %sType of %s does not check in B object "%s"Key %s does not check constraint in B object "%s"bsAddData received a non magic B obj (%s)bsAddComment received a non magic B obj (%s)Attempt to add unknown comment type %cbsAddArray received a non existing array %dbsAddArray received an array of wrong type (should be BSunit)Incompatible width in array and objbsAddArray called on bad target %sbsRemove received a non magic B obj (%s)bsPrune received a non magic B obj (%s)Model screwup in bsPrune: %s unmatched in %sTrying to update a non bs voc with bs packageuse Read-Models from main-menu and/or check wspec/models.wrmUNIQUE right above something else after tag %s in model %sUNIQUE right below something else after tag %s in model %sMissing tag after XREF in model of class %sProbably, the tag variable used was never initialisedbsGetPath receives tag %d < 0 or > tagMax = %d, %sProbably, the tag variable used was never initialised, have a look at tags.cfindTag receives tag %d < 0 or > tagMax = %d, %sbsType called with %s - must be right or downCan't crossref %s onto %s because %s is lockedbsCoordShift set for illegal type %sbsIndex set for illegal type %s-Q=?GCC: (GNU) 3.4.3 (csl-sol210-3_4-branch+sol_rpath).symtab.strtab.shstrtab.rel.text.data.bss.rodata.str1.1.rodata.str1.4.rodata.cst8.rodata.cst4.comment4kL hp %L+L02Ld?2 NNV[VhV4VqhY A 8g.  &>"V(n.7 BKT_f n$x(,0F<B @V$=48<@ DH L)!W1;p-E)fOPVT]Xf\l`v827_AaHtlpx|dhJK  *CJ)W^`w,,g4*3<GV\huz~{e  $,+/4A JWan{ &#GGn _H ,'0'A1<SFNX'cMmxv~A "g+9AP3^vH#k$2C'w?" *6%,zC,(U`F05hz{2$,7d7JVes}<D EFF~F_GPH   IR! Ljbssubs.c_unameunamestatlstatfstatmknodtabModeltabAssPathnCreatednUpdatednDestroyednSavednKilledOBJhandlefreeOBJstacknOBJusednOBJallocblocSize.0OBJfreelocalModelobjDecoratebsDoUpdatebsDoSave2doXreffindTagmark.1units.2bsGetKey2mark.3zero.4currStack.5unit.6viKeySetbsViGetaddKeyTagxrefPrunebsAddCellmark.7path.8workPathdepthpathTablemakePathsbsRFreebsSubFusebsCoordShift2isShiftAfteriShiftdiShifttShiftshiftTimeStampfShiftdfShiftbsCoordIndex2cIndex_nuname_xstat_lxstat_fxstat_xmknodisTimeStampsXREF_DISABLED_FOR_UPDATEBSTESTBsSubsStatusOBJallochandleHandleCreate_dbgstackHandleCreate_dbghalloc_dbgstackExtend_dbguMessSetErrorOriginuMessCrashuStackDestroyuMessFreeOBJstatusOBJShutDownbsKeyisModeluArray_dbgbsMakePathssessionAutoSavebsCreatepickListlexAliasOfexternalServeriskeycacheCreatebsCreateCopynameclassNameREADING_MODELSlexGetStatuslexUnsetStatuscacheUpdatecacheCheckbsUpdatebsClonecacheClonebsGhostbsPushObjbsDoDestroycacheDestroybsDoKillexternalSaverbsGotobsRemovebsGetKeyTagsbsDoSavebIndexObjectcacheSavelexSetStatuslexAlphaMarklexmarkbsFindTag_VComment_VUserSessionbsModelRightbsModelMatchkeyGetKeybIndexFindbsGetKeykeyGetTag2KeyuArrayReCreate_dbgbsMarkkeyFindTagbsParentKeybsFindKey2bsGetDatastrnew_dbgbsGetTexthprintftimeShow2bsGetArraybsFlattenbsKeySetuArrayCreate_dbgkeySetOrderarraySortarrayCompressbsTagsInClassuAssNextbsIsClassInClassuArrayDestroy_dbgbsIsTagInObjuAssFindbsIsTagInClass_VTextbsKeyTagsInClassbsAddTagisCacheLockedmessoutbsGetTimeStampbsGetNodeTimesessionUserSession2TimebsSetTimeStampcacheMarkbsAddKey_VConstraintsessionUserKeynameWithClassmesserrorBSallocBSfreecheckKeybsAddDatastrcmpBTallocstrcpybsAddCommentlexaddkeybsTypebsAddTruncatedArraybsHandleMarkbsGetMarkAsStringmessprintfbsPrunestackReCreate_dbgbsFuseObjectsaceOutCreateToStackdumpKeyuAceOutDestroycacheKillbsTreeKillpushTextcatTextstackText_dbgparseBufferInternalassClearassHandleCreate_dbgbsTreePrune_VModelbsTreeCopybsMakePathShutDownuAssDestroypickClass2WordarrayCopy_dbgassInsertbsGetPathlexMaxpickWord2ClassstackCursorcacheUnlockbsSubFuseTypebsFuseModelbsModelRootbsModelCurrentbsObjectCurrentbsModelKeysprintfsscanfbsCoordShiftbsCoordIndex AA5BMCeDEKL,M7BQainNvOPCQ^Rm|NOPR"VJVWXW YB[N\Y]i]u^_\[]]^_Y\m[}OabPVcOP]dde&]9fMHZgcOP\[ Oa b).P@f^j[OPfHUchWyXWOaPn & p5 pC qQ ra su t{   p p  m   O a  P" ' O. 3 PB Y\ a Oo a} a  P p p H g u v w d e x' y6 dI wU xa yj p~ p  O  P> {F |N {T |r } ~  O  P  Z/ 7 mc m r w   Z s      qsmSyZzm}}9{A|f~{|z1sAGLWgmqysOVKfOP$KS[wMaRWO`eP{OPzO&+PDIOPUPOP1{=|JfO$Pi}W16?W[Zm/:M[jwWXWW:[T[W,XO]bWl[^^ W%.WE}V}[ WX.5:WOaPa8bOaPO#PGLOSXPsxOaPL NkxNN , Nc x   }  a  /!7!P!~d!as!a|!!!!!!a!a!!!"G2"[L"U"L""N""ND#{L#|#~#H$M$OZ$ac$h$P)%+%%%O%%P#&&&R&&M&&'O ''P'/'t'y'O'a''P'{'|'a'({(|,(a8(Y({a(|h(o(({(((O((P((L()N@)J)N)))**M*R*O]*b*P{**O**P**O**P**O**a**P +%+r1+:+@+E++++++q+z,r:,D,Mf,k,Or,w,P,,,,,-O --PL-X-]-W-{--L--N..NK.~v..L..N./Nx///O/a//P$0q30p0u0O0a00P000000 111N 1*1Q1f1k1Wx1111O11P1}1{1|2~22O(2a72a@2E2PN2m2r22L22L22L2222h3o 333,343?3aN3bW3\3f3n3t3~333333333333334Q4Q34;4D4V4Qu44444444[44O44P45 5W5%5*5W45F5M5Y5`5e5Wt5{55W555W555555W5Z66O"6-6b66;6@6PN6Z6a6f6Wq6mz666666666W666WX7s7{777777 88"8'808:8J8P8U8^8m8u888888899O9"939a<9A9P]9b9Ok9p99a99P9 ::::W':-:7:>:C:Wl:t:y::::O:::a::P::O; ;;;P8;@;a;[;;; <I<V<b<g<Wx<X<<<W<<<O<<<<P<==B=I=N=W===O====P====W&>}F>{N>|]>{c>|>>!?|??|?(@-@O5@a>@C@P_@j@as@}@a@-A=AVA_AHnAgAAaAaAaAA3BHB}eB}BB{B|B{B|C}jC.D{6D|TD{\D|dD{jD|DEO EEP E%E0E=EKEPEWaEXqEEEWEEEEEWFXF&F+FWgFtFFFWFXFFFWFFFGWGXfGsGGGWGXGGGW{H~HHHHHHHH II+IAIVI\IkIqIIIIIOIaIIPI}JqJzRJz[JhJqJJ=J=JJ=J=KK KK,K>KZK~}KKKKKOKaKKPK}LqLz L,L1L6LML_Lcheck.o/ 1133374767 530 202 100644 1728 ` ELFp4( UuUuU u ujU u ujU u ujUuu ujËT$t :uUWVS]u Eƿ8uiEUBU„tVƒatnt,u9C"u#C 8tCMAM„ue[^_øUE t/wt%tjph$FORMAT check.cbadtype in checkDataGCC: (GNU) 3.4.3 (csl-sol210-3_4-branch+sol_rpath).symtab.strtab.shstrtab.rel.text.data.bss.rodata.str1.1.comment4 Pp%+02%?4%H   &>!V'n-5<DLTfpu}LRDcheck.c_unameunamestatlstatfstatmknod_nuname_xstat_lxstat_fxstat_xmknodcheckRegExpSyntaxcheckTextname__ctypecheckKeycheckDatauMessSetErrorOriginuMessCrash   5Me w | dnasubs.o/ 1133374767 530 202 100644 17016 ` ELFl)4( UuUuU u ujU u ujU u ujUuu ujUVSu^ t~tjhh$ jihSVjjhjVX ^ e[^UVSuN I9sCI9r9u hhv VN e[^VS\$T$yt$ Jtv;t CJuD$ [^ËD$H ItBIuËD$H ItBIuËT$:tB:uËD$H ItBIuUWVS }u ]u1 jhhhh"yC9_ }_ jSVWu e[^_UWVS u} ]t~u~u?yC9^ }^ uh:u$SWVu e[^_UWVS\u Et >t}uGhh ?}tHPt H>uIPhEuHPh:ut EIQ)Í)Mut^E EE9]}J}tD} ufE2EPhNutEE9]}}u}t>]uuSED D ShNutEEe[^_UVShQju Ãt` S$ p jPu 9tth9hSth:hVe[^UWVS}] hQjSƃ S$ PhSW4$PhMhs SK 3hNWhbW9tthShVthThSe[^_UWVS(hbhjjhEEuuuƊF<>KE>u uƃt>u u u uEPhfuƃ}t8>t8;FÄ؃EthhWGuUaÃ910}T*tO*  ~< t7-tXt xhhWGuFÄb u t85EPu $uu }thhuh}thhuu t= PPu PuPh4U e[^_UWVSM EUt x 9}9Q } )A1E508U5$~e04~>UJt  AJu1KtFAJtKu AG4$98PhNuKe[^_ËD$P ~2Jt'AtHw tJuٸUVSu5EPV$5uta uÃtMjV5Pt+EPjj!StE ;Eu SJ S uÃt*V5PE Pjj!SSe[^UWVS,} w tVuEEEEWt* tWh*hjWh*hjW  h+hjW҃h,hjWEԋGUԍ B˃~ ACt C+EԉG +D؈AD AD A \hFhjWhGhjW‰yF) hHhjWEԋG@Mԍ ~=TAD AD A T؈CNtUjjuu ju Ujju uUVSU;u RÃEEE}tUE REEPEPEPjjR tD juuujƃ t&Ehcu VÉ4$th{hs SK ؍e[^UWVS U}u;u RÃEEE}tUE REEPEPEPjjR tfUE)@9Y9U|uƉ)E)փ jVWujƃ t&Ehcu VÉ4$thhs SK ؍e[^_Uuhhhhhh Ujjju u~ Ujjju ub UWVS }u E$EEuuju `Ã}tOPu AE hhS]}u u Ph]9{ }{ 9s }s ufus u{ Fws 9~ SC )G)F9tMONEB<wEPVWSu uE # u u PVWSE th8hSEe[^_Ujjjuuuu u U ju uU ju uUWVS }E utxuxt xux u p PEEx ~B jVjhahuu0W! EUE9P }thehuShj؃e[^_UWVSu5V6 Và 5PEU B EǍEPjj!StEPjj!S S}|9}~0uuWjVPhE} E+E@ hhjjPNjuNE ;u}8hhuWhhVu  FE;u|hhw WO e[^_UWVShQju Etx u hhPEX 0tCt#FPhuGK1u݃hfuuhfu}thhue[^_UWVShQju Etx u hhPEX 0EtHt(EFuhuGK1u؃hfuuhfu}thhue[^_UWVS(uhhjjhEE  ;t!hh$T}O}*hhEP@ESUWVuŃ V VtWVu V{ 5EPu $uƃt<jEPh u uVEPjj!VVhQSu th1hSM V Pu PhUth7hSe[^_UWVS(hAhjjhǾEE  ;hFh$cE)~}hNhEP@EWރEPuu u utEPuq u 5EPu $uÃt<jEPh u uSEPjj!SShQWu thlhWO u Pu PhUthrhWe[^_UWVS(} u]EE)@EWE}tx 9}U9Z  }Cu uEN]CjSu }QuuE Cc jSu jEPuE CD jSu uUBPuE C# jSue[^_UWVS} hQjWƃt Vhhp PS BC jCRjSWu 9tthhVthhSe[^_dnasubs.cbad call to dnaCopydnaFailed assertion: (%s)>%s dump_outdna %sc?DNA?%s? ?dna?? wI wrote %d sequences%d QualitySCF_PositiondnaRawDumpFastA() received a NULL parameter: %s%s DNAparse error at line %7d in %.25s : bad char %d:%c Mismatch error at %d in %s. Do you wish to see further errors?Choose a file for export in fasta formatObject %s has no CDS tag so CDS DNA cannot be dumpedThe start/end of the CDS in object %s is outside of the spliced DNA coordinates for that object (spliced DNA start = %d & end = %d, CDS start = %d & end = %d). Make sure the CDS positions have been specified in spliced DNA, not Source_exon, coordinates. CDS start/end positions have been reset to start/end of spliced DNA.baseQualityParse called on a non-BaseQuality keyError parsing BaseQuality %s at line %d (not an int 0-255)basePositionParse called on a non-BasePosition keyNon-integer parsing BasePosition %s at line %dGCC: (GNU) 3.4.3 (csl-sol210-3_4-branch+sol_rpath).symtab.strtab.shstrtab.rel.text.data.bss.rodata.str1.1.rodata.str1.4.comment4 7 %  + %02 %?2%'N(4)W$+P  t2B &>#V)n/~97 H FW dT rc?{%h c%9DO]bo~NB""%ys*|:AISe qv  '0:FOXbkvha, "02LLh]`j}\1$1-dnasubs.c_unameunamestatlstatfstatmknoddnaDoDumpdnaUnpackArraydnaPackingTypemodifyLengthdnaExonsOrdercallbackerrorOK_GdnaDoGetdnaDoCoordGetdirectory.0filename.1dnaDoDumpFastAKeydnaExtractCDSdnaDumpCStylednaDoDumpFastAKeySet_nuname_xstat_lxstat_fxstat_xmknoddnaCopyuMessSetErrorOriginuMessCrashuArray_dbgarrayCopy_dbgreverseComplementcomplementBasednaDecodeStringdnaDecodeChardnaDecodeArrayrnaDecodeArrayrnaDecodeChardnaEncodeStringdnaEncodeChardnaEncodeArraydnaRawDumpmessAbortOnCrashdnaDumpFastAaceOutPrintdnaRawDumpFastAmemcpydnaDumpuArrayGetuArrayDestroy_dbgjavaDumpDNAnamefreejavaprotectdnaParseuArrayCreate_dbgaceInCardBackaceInCardaceInWordaceInPosaceInWordCut_VSequencelexaddkeydnaStoreDestroyaceInStreamLinemessprintf_DNAbIndexTagbsCreatebsGetDatabsDoDestroybsUpdatebsAddKeybsAddDatabsDoSavearrayStorednaRawGet_VDNAdnaExonsSortarraySortmessQuerydnaGetdnaFromObjectdnaHandleGetsMapLengthsMapTreeRootsMapCreatesMapDNAsMapDestroydnaFileOpenaceOutCreateToChooserdnaDumpFastAKeydnaDumpFastAKeyWithErrorsdnaZoneDumpFastAKeymesserrordnaDumpFastAKeySetdnaDumpCDSFastAKeySetkeySetAlphaHeapmessout_CDSbsFindTagbaseQualityDumpbasePositionDumpbaseQualityParse_VBaseQualityaceInIntbasePositionParse_VBasePositionaceOutBinarydnaDumpKeyCstyle 5Me ! # $ % &((%(1 :%}**-/ /32@ E#M R W$ 4. 3#; F P Z ` e$w } 4 4D6Z b4 8 9 9 #8>;F<O U4e+r {% 4 4 9 9 >"?-@8A_A?AB C/ %v %@D;EF 9 %9H;WG` eH0 *l  t 4 D ; E I J K* I0 LE L] Mk My N I O P Q +'  / %A  I %X  ` %|  %   %$  , %M  U %   R"  ( 9  >  %E M%j w> % $%A N>^ f%0T  8> D9 > %VN T9p~; W TSN[o\]^_ %TSH[i\]^_ %  " 'a 9; e9';3 9dbh % 9 ij J!K7j=khL}LM; e > % "%< E%f p8 9 4 4 4 9; E8b h9 4 4 4 9$ 2>JoY ^#e j$ %pA@pAD;"E-ND IEXOfPoQz R 9G; H 9 ><rO T#[ `$ %pA@pA"D.;6EANX ]ElOzPQ R 9G; H 9:;n+sssssss: B8e n% 9 9dnacode.o/ 1133374768 530 202 100644 1384 ` ELF4( UuUuU u ujU u ujU u ujUuu uj-atwgrkdcmyhsvbn.-auwgrkdcmyhsvbn.             GCC: (GNU) 3.4.3 (csl-sol210-3_4-branch+sol_rpath).symtab.strtab.shstrtab.rel.text.data.bss.comment4 80% +049XP   &>#V)n/7>FNVdr*@dnacode.c_unameunamestatlstatfstatmknod_nuname_xstat_lxstat_fxstat_xmknoddnaDecodeCharrnaDecodeCharcomplementBasednaEncodeChar   5 Mepeptide.o/ 1133374768 530 202 100644 26768 ` ELFI4( UuUuU u ujU u ujU u ujUuu ujU 5EPhPu* ut hU ju u>U ju uU ju uHUWVSEEEUMEEUBtm EEUBtFhhYu Vu }uUuM8t}t EX@C~GzE}L}u EXE}tMU Ee[^_UUBEBEEuu EPUUEBEBEuu EPUWVSD$(D$D$$tgH t`ItX: u  : T n D$ D$ $CIuV $<$ $,$ $d$L$ L$( $|$fD$ fD$l$\$ l$D$ [^_]VSt$ tON tH؋T  It%EuCIuv [^ËD$H ItBIuËD$H ItBIuUWVSE X 8~qhjV~+1KtGFJtKu FAO~˃Phcue[^_UVShfju Ãt&Pu> hhYSfe[^UWVS} hfjWà W$ PhhuShhYs SK 3hcuhu hhYSfe[^_UWVS E}t } t}u1 jhhYh4hE ;t!hhY$` hhYjh5 }VFDŽxhhYp PFuA PPu PuPhUE }FDŽu} uƃ<} ut uƃ}ub<*uH Ex tBPu Eu( u PhUEEe[^_UWVSl$} v1}u Љ1C9] wՉֻ wЈ1ƃ v[^_]UjuUWVSEU;uhfjRà uƃEP5VtCE ;u7 V hfjuÃz-EP5Vt& Vuƃ5EPuEu V uǃ} EE5Vu V]}EPjj!VtUEPjj!V9]|9}~:uuWSuPhV=]}5VE} t7t2SuPh4$EPjj!Vt=UBv2RuPhP4$]KWSuǃu VZjjPuÃhhYs SK thhYWt V؍e[^_US] PU;u 5EPR$-E ;t!hhY$5EPu$tC E uuÃju5PtV SuÃ`ju5Pt S S+ ShfSuSEuÃju5Pt`EPjj!StKE;EuCj!SuEPjj!StE;Eu Su S uÃtPu5PEPjj!Sj!SuEPjj!S SЋ]UWVS}u V PhW4$ÃEP5St u PhWEP5St u PhW5SthW5SthW S VPhhWe[^_UVSjhhh@h@hà tu uPƉ$e[^UWVS}] EEPSu$ SPh<jjuP ƃu$ SPhhSW~ |ShhYCPVPhW2؉љuhWC9^ }2؉љthWe[^_Uuh hh@#h@h UWVS\}]9}a9}31E E؋u FuCD)A9}JuD) D)EPhcu9|e[^_UWVS }u ]t8yC9_ }_ uh uSVWu9 e[^_U ju uUWVSu uVÃt8 u VPC HPjSǃhhYSe[^_U ju uU ju uUWVS }E utxuxt xux u p PEEx ~>VhhYuu0WEUE9P ƒ}thhYuSh؃e[^_VSD$ P@HPlpPjhDPl}l}\|Ix6t#p}E hhYjj j@dDžh xhEtEpEEP1DžxdhhYPdUh T=U U< M҉P|< *҉PAh?`h@t&dt#hhYdd lt#} tE 0=t)SV( VPh؍e[^_UWVS} u])@EWE}tx 9}E9X  uEN]CjSu }QuuE Cc jSu jEPuE Cp jSu uUBPuE C# jSue[^_UWVS} Wþt, @ HPjSWuƃh%hYSe[^_U ju uUVSuEEPVu VPh<1uju P,Ãu VPhh؍e[^UWVS}t} u1 jhhhYhJhE @ EVUUUmM)ˉ][U)ƒ hthYjjCPEEPuM 1>ƃ%s %s: %s (start missing) (end missing) apepFile to add translation to%cw>%s I wrote %d sequencesTranslationStartBase1Base2Base3code_table && obj_dna peptides = starts = stops = No model for Proteins, please edit wspec/models.wrmparse_io && key != KEY_UNDEFINED && errtextpeptideParse called on a non-peptide key peptideParse error at line %d in %s : bad char %c (0x%x)The start/stop positions set for the CDS in object %s are outside the spliced DNA coordinates for that object. Make sure the CDS positions have been specified in spliced DNA, not Source_exon, coordinates. (spliced DNA coords are %d to %d, current CDS coords are %d to %d)Data inconsistency: the Start_not_found tag is set for object %s, but the CDS begins at position %d instead of at 1.Data inconsistency: the Start_not_found tag for the object %s should be given the value 1, 2 or 3 but has been set to %d.peptideStore called on a non-peptide keyCannot open object for sequence "%s" to set full peptide dump titleCould not get a translation table for "%s"Could not translate DNA for "%s"Choose a file for export in fasta formatKNKNIIMIRSRSTTTT*Y*YLFLF*CWCSSSSEDEDVVVVGGGGAAAAQHQHLLLLRRRRPPPP%s does not specify genetic code correctly.Translation table derived from %s hs(@6[ ?3ı.n,@>W[/@x&1@@= ףpS@@GCC: (GNU) 3.4.3 (csl-sol210-3_4-branch+sol_rpath).symtab.strtab.shstrtab.rel.text.rel.data.bss.rodata.str1.1.rodata.str1.4.rodata.cst8.rodata.cst4.comment4c 0[ )@$ % f /A 42AC2hDKRH0_HlH4 IuK / Te &>#V)n/; C: KT Sn [ c l ryR,&FlF iAP6@ @@@#*+|4eF[XhzQR      !'19HT_nxb~%"G"TN .9CVfq{ s!l;e$.8IWaku~[ #2,>[K[nUV2F~V]peptide.c_unameunamestatlstatfstatmknodpep_debug_GC_atomsH_atomsN_atomsO_atomsS_atomsSe_atomsNH2pKCOOHpKLateralpKdnaStrictEncodeCharpepInitialiseE_codonE_reverseCodonE_antiCodonpeptideDoDumppep.0doDNATranslationwriteTranslationTitlefname.1dname.2directory.3filename.4pepDoDumppepDoDumpFastAKeypepDoDumpFastAKeySett_codon_codepepGetGeneticCodemaps.5printTranslationTablepepDumpCStyle_nuname_xstat_lxstat_fxstat_xmknodpepDecodeCharpepEncodeCharpepNamepepShortNamemolecularWeight_VModellexword2keyiskeymesserrore_codone_reverseCodone_antiCodonuArray_dbgcomplementBasepepWeightpepPIpepDecodeArraypepEncodeArraymemsetaceOutPrintpeptideDumpuArrayGetuArrayDestroy_dbgjavaDumpPeptidenamefreejavaprotectpeptideParsemessAbortOnCrashuMessSetErrorOriginuMessCrash_VPeptideuArrayReCreate_dbgaceInStreamLinemessprintfaceInWordaceInCardpeptideStorehashArrayFREE_UPPERpeptideGetpeptideTranslatebsCreate_PeptidebsGetKeybsDoDestroy_Corresponding_DNApepGetTranslationTablesMapLength_CDSbsFindTagbsGetData_Start_not_founddnaFromObject_VProteinlexaddkeyarrayKillbsUpdatebsRemovebsDoSavearrayStorebsTypebsAddKeybsAddData_Locus_Brief_identification_End_not_foundpepTranslateAndExportaceOutCreateToChooserpepTranslateAndOutputuAceOutDestroypepFileOpenpepDumpFastApepDumpFastAKeypepDumpFastAKeySetpepDumpCDSFastAKeySetkeySetAlphaHeapmessout_VGenetic_code_Genetic_codebIndexGetKey_Source_S_ParentbIndexGetTag2KeyuArrayCreate_dbgstr2tagnameWithClassaceOutBinarypeptideDumpKeyCstylepeptideDNATranslatepeptideDNATransprintfputchar //50M1e239 :;< @5ABANAzAAA!*5@PZhz94[5F4 G I4 :J` hI~LM GD @ G G J0O= BPJO TQcRr wP~Q S5 @L T).UiVWVXL UK4RZ\R I] ^ _# R. `;  E Ii ao _ ` ] b ` c d e `8 fM fp Ly ~ < ` g e L  < ` f' L0 5 <= `[ hm `  @  J ` i R L j/ R>  C PJ O Q[ ig Lo j k ] ^ f ` l ^ f m n `.  7 o= YK ]c ^i f~ f p f ` ` l ^qrp1r=naLj pGx]s_L Gt_L Gge G#u)e8 >GJ`XLaf<q wG   wxyb L<GLPU< @ G G G   "wg4 G G0\HLY{h nJ &@[ cJo t+3DLs   @ @! (-@C]b gvf f f f $3fO Tcf c o@ J`3<A<nLD+Ac[ JbL<#L,1<\Oi nPv { Q  @$ -@C5u ~@5 @5 @ @(5`inu z @  @  & -@BU  $ ( , 0 4 8 < @ D L P T X ` d h l p t x |      $ ( , 0 4 8 < @ D L P T X ` d h l p t x |    matchtable.o/ 1133374769 530 202 100644 10912 ` ELF4( UuUuU u ujU u ujU u ujUuu ujU=jEPhE%P}jEPh E%T}t}jhLhP  hh%Dh+h%H D%XËL$T$+ttA +B thA+Bt\A+BtPA+BtDA+Bt8AbɺE@tEu؉UWVEu hh0p PE UB#XBe^_UWVEhh0p PE Nju EUU BUB U BUBU B UBU BUBB#XBe^_UWVS} uÃ8t8-t C;t ;-u;u6 PtPWCPt-e[^_UWVSE/u+ u Phh$U hh0j$h5hh0j$h5 hh05EPu  u Ph=h$Mhh0p PE@޿X8uDu܉F uÃt Sƃu+ u Ph[h$U uÃDVEPSEEM܉ uÃ5TEPSEEu܉FEPuEFEPuEF EPuEFEPuEFEPu]^V)֋U܋BP֋M܋A%ҍPI ‹M܋%֍ۍƃp V53EPV5u!hh0$HUJPu;uЍe[^_MatchTableMethodMatch_tableDELETEMatchUSEDmatchtable.cbad MatchTable object name-Dbad class%s-%sbad object nameno method namebad method nameno scoreno q1no q2no t1no t2no object namekkfiiiikk%s %s %s %g %d %d %d %d %s targetmethodscoreq1q2t1t2flagsMatchstampMatchTable initialisation failedMatch parse error: %s at line %dass problems in matchTableParsewrong class %s in matchTableKillCan't kill badly named MatchTable key %sGCC: (GNU) 3.4.3 (csl-sol210-3_4-branch+sol_rpath).symtab.strtab.shstrtab.rel.text.data.bss.rodata.str1.1.rodata.str1.4.comment4! ! %X+`\ 02`&?2N=4qW@ " F& >&V,n2FMXPeTnL{ $DHX{GK|} \ '3=BMRaDq",6AKT^fo)'P2 !3matchtable.c_unameunamestatlstatfstatmknodisInternalArrayKilldone.0initialise_VMatchTable_VMethod_Match_tableendKeyendMarkerFLAG_DELETEFLAG_USEDsaveMaskrowComparerowAddreverseRowAddmatchKey2Parentma.1ma2.2mHash.3saveMatchmaNew.4_nuname_xstat_lxstat_fxstat_xmknodlexword2keylexaddkeyflaguArray_dbgnamepickWord2ClassmatchTableParsesessionUserKeyaceInStreamLinemessprintfuArrayReCreate_dbgassReCreate_dbgaceInWordaceInFloataceInIntassInsertuAssFinduMessSetErrorOriginuMessCrashaceInCardarraySortclassNameuArrayGetarrayStorearrayKillbsUpdatebsFindTagbsPrunebsDoSaveuArrayDestroy_dbgbsAddKeymatchTableDumpflagSetDictfreeprotectaceOutPrintflagNameFromDictmatchTableKillmesserroruArrayCreate_dbgmatchTablebsCreatebsGetKeybsDoDestroytableHandleCreatetableSetColumnName ""5#M$e%& ' ' (#+ 0 5):B G L)QWci !*:\ e*+,#(N.e/nsx0 1 1 2/ "09 >G*X r3,/ 03(3(2(Z4z5555FPU6ns7 89Vi3  )3 ).:@3Sjp;z * 0 6 ; ;E  J S *Z k z + <  0 (   /   0 /    07 /@  E J 0b /k  p u 0 /   0 /   0 /   0 /    00 /9  > C 0p  }  1   =  *      < R Z v         >  ? * @< B AR B^ Cx  D        > @ EC3 8GX b=+H< I+H IJ I4 :D` 8<9+L =+?1@@RXAhBtC * M.6;@ L*Sds+< 0( D =-OLRPbQw = R S S S S S S S  (S0 8Sbasepad.o/ 1133374769 530 202 100644 10280 ` ELF4( UuUuU u ujU u ujU u ujUuu ujUE@;~h=t 5jHhjP;}B;|U=jh h jhh jh,h jhh# jhh+ jhh8 jh hG jh$hS jh(h`UWVSEPu uhdjuǃX s jrhjjEtE jshUDHPuO st%ETJEPONuۃhduuUB EEPjj!u tjzhW}tjzhue[^_UWVSuEEP5(u hhjjU B u4NjE X s hhUDHPWU J st%ETJWE H  NuۃWu u} thhu e[^_UWVSX]SE$EE hfhgSP UthhP} } }u5 u hhjMA PEEEEx ~-UMQ<]M܋EUL@EU9B ӋM9M}c u uuSE$E u5P u5uuu hhjjh E؃hhjjhEԃ ju5uvEEE؃x EUBEu PEЃu% EUB4\EЃE@UBы4EA<EA94)CJU;Dt MЋ;Du#KFG'U;DtMЋ;Dt݅}t8E܃UB@M9uEHMA@U9umnhhE܃PuM܋EHE E@UBE EEE܃UBE EЋE~7MT+MЋD+9uKFG~ET+MЋD+9tE܃UBE EEE܃UBE EЋEEKFGU;DtMЋ;Dt݅EUB+CU;Dt MЋ;Du#KNGpU;DtMЋ;Dt݅P}t8E܃UBHM9uEHMA@U9umnhhE܃PuM܋EHE E@UBE EEE܃UBE EЋE~9MT+TMЋD+9u KNG~ET+TMЋD+9tE܃UBE EEE܃UBE EЋEEKNG~ U;DtMЋ;DtE;tt PEUM9Q } /E}thhuEԉE؃ hhjjp EEEEEEEE U؃z UMQEE@A4EA<EAEEAUE9Eh!h]܃SuU܋MQM̉ E@UBMȉ E܃UBM E܃UBMĉ EXM Euȉ}EEċUU MMċEEUŨEME9H }h3h]܃SuU܋MQM̉ E@UBMȉ E܃UBM E܃UBMĉ EXM  jju5u h>hjh uE؃h?hjhuEԃ ju5$uEEE؃x gEUBы4EA<E@A)XU;DuKFGM;Dt}t4E܃UB@M9uEHMA@9umIhNhE܃PuM܋EHE E܃UB<tUDH;uFGKt MDH;tE@UBE EEE܃UB<EKFG~U;Dt EME9H  jju5$u }th`hu}thahuEP5 ut9u udt PEPj"uuǃ5 ut5u}thqhu uEe[^_UWVS(uE؃ hhjjj2à jP5u5uu{ 6KFCEFCEFCEFCE܃ 4 ǃEPj5,WtuEPjj!Wt`E9E}-M9M~ U)EUE9E};U+EEU+M9M~ U))EUE9E}U+E)EU܃ WFCM FCM FCM FCM܉ 9s  jjS5uuthhSe[^_UVS]hfhjÃx u$thhP x ~7p h4thhShhjPEtJhhS25EPSuShfhfhuƃX Kt$hhSV0Ku܅thhVe[^ST$L$ ;w%;rB ;A  B ;A K[UWVS(uEuEE_}75 uEP BUhhjPE$hjjh EE jP5u hhjj]܋K gfff)PEؾ E܃x ~,hhSCuMQ9q ԃhu]؃{ ~?EPJ9J}AEB 9:u ]9}:RUFE9p h'hjEPǾ;u}UFC;u|;]~` u WuuEuE W5P W5uWuM܃y t8]؃{ ~*h<h$\FE9p փ}thBhu ue[^_USs5EPut\ uÃtC5 Pt S j$Ћ]basepad.cPaddedUnpaddedClippingQualitySCF_PositionAssembled_fromSubsequenceAlign_to_SCFDNAc>Assembled_from PaddedCan't find sequence %s>SubsequenceFIND Clone ; Main_clone ; FOLLOW Assembly ; Padded%d padded assemblies, aborting depadcode not yet written, rd owes jean a beerGCC: (GNU) 3.4.3 (csl-sol210-3_4-branch+sol_rpath).symtab.strtab.shstrtab.rel.text.data.bss.rodata.str1.1.rodata.str1.4.comment4 0! %L+L002L?2Nv4W  l &>#V)n/8?|GNY ak,u~ $( * 6=&&/8BS^is (1:D-mJ\fq}basepad.c_unameunamestatlstatfstatmknodidentityidSizeidCheckdone.0initialise_Padded_Unpadded_Clipping_Quality_SCF_Position_Assembled_from_Subsequence_Align_to_SCF_DNAdepadSequencefixPhrapClipsafOrder_nuname_xstat_lxstat_fxstat_xmknoduMessFreehalloc_dbglexaddkeyfixArraybsGetKeyuArrayGetuArrayCreate_dbguArray_dbgarrayStorebsAddDatauArrayDestroy_dbgfixDNAbsCreatednaStoreDestroybsDoDestroydnaGetbsUpdatequeryKeyParametrizedbsFindTagbsDoSavebsCoordIndexbsGetArraybsAddTruncatedArrayuArrayReCreate_dbgbsAddTagbsRemovebsGetDatadepadqueryParametrizedmesserror_VSequencelexword2keymessoutpadReadpadContigarraySortuMessSetErrorOriginuMessCrashpad 5 M!e"#$ % # (&27 <&FK P&Z_ d&ns x& & & & &( )) 9*F W+ ,- . .0)1(I ^*v +12 .3%47 < B5\ b.6 %7&/54DJ'V^'l8| * *9. + +  $   .0  < *  +  +7 ? :O  ^ ;n  } ;  9a  p +3;:Q Y.o w.($(6< .$7C4^ i*w96=0 >(>2:7 .I NU@q w.A . + .B C D1 6 >5V ]+ .03 (6G T%c q*9 * +Gv %2/4'' 81 6H=BIa i.w7BC062?2smap.o/ 1133374770 530 202 100644 20032 ` ELF44( UuUuU u ujU u ujU u ujUuu ujËD$@ US]M {t C9tJEPQst.EC{thhsCUЋ]ËD$@ËD$@UWVS$U]u}EPuu rr rƒ tE؉tE܉tE} tEM Ѝe[^_UWVS]u}{u%hhC0sC$5EPuu ss snƒ tE؉tE܉}tEM} tEM Ѓe[^_ËD$T$ uBuP9T$9BUWVS E ]EEuÃ}uE}t EXUP ;]~؋]EEMA HA 9\duU9OSuƃ9~:XM9u MM}t8}t UB (MA@ ;F~ +^ +F)Ӄuu@99sMu9q}FQ uF HF9u MM}t9}t AMA(AuF Q ;Q~ A+E) A+EQ }t(9E9P9X|M9Y 9~ 9Q}M}t}t u^EP}e[^_ËT$  w:t}w,to8te^>tYKtOHbt@ws@t.t!ttUWVS$u}u uƒt9EPuurr rB putE؉tE܉؍e[^_UWVS,}w^u^ 7&Eԃu_E u6ww uV= Fà }thhuEPuu Sw wƒ }tE؋M}tE܋M}tEM} tEM Ѝe[^_UWVS }u hhw WF ƒx ~"ЉP4WCV 9Z ލe[^_USh%hu jj ÃEpSo؋]UWVS]EC+{Gh@hu jWƃ EPusVbt2}t,}t&~ ~t (B@9V ~ thYhVe[^_UWVSu hP6tuuVuUtfF ƒx ~0uuЉP4utCV 9Z Љe[^_UWVS8EU Bpu܋@E2E}qEPhPut uEu uEPjj!ut UB ;E} uF E}6}thhu uE xt[E@ƒx ~IEB KAH9~";]}؋uF$CAH9~;]|EE Pu9r EU Bƒx EB0uԋPUЋXH u ~;U~ UE))U;]} E)Eԋ];M~ +E)EЋM؋E9E+E@U9B }B +E܋uF>EHUB2E9EMƒt99t/U:t:u"}tEPuUUG FCE+E9}u;u~ U)U;M}E))E;]~ +EEԋ]؋E9E+E@U9B }B +E܋uF>EHUB2E9ExvEƒt7E9t/U:t:u"}tEPuUUO EFCE+E9}Eu VE9B  u}thhue[^_ËD$T$+UWVSEEEE}t} t }t}u1 jhGhhhjuƿx hOhWV}t SUtUSu jjURURU2U2P u# S;E}]܋UUUUEG9~ wth_hV}tU܋E UEUEe[^_UWVSHuhxhjjjEEjVjuhPV tEEjuhPVtEExjuhPVtEEE}thhuSVt S~SVt S hhujEp VUUUEȉỦ)RǾ UR UĉEȉŰE)ƒ~{hhVWUB@‹]ZAzt!zyE+BHA BHAFEX VUUUEȉỦ)9h~ WG HGU 9U~Vyu9Y+}EȋA+A}9E}CAA+A}HEAA+@E}AHA Vyu9Y+}EȋA+A}9E}CAA+A}HEAA+@E}Q)BQ FG H95G HG]Y yu.E 9~+A}EAA+A }EA}t.U 9U~ M] 9]} EMU }thhue[^_Ujuuu uH UWVS8hhujU B UB HPEԋE ‹@ HB Q;T 0EE x FEЋU B2EPv vuuuà ph$hEp Pǃu)E+FE؉GV +UF)ЉGE܉G E+FE؉GvuÃ@;E}E+FGC G h7hUr RNj+FCGS;U|F +EV)‰WE܉G EЋUЋE 9P *EE x EЋU B2EPv vuuuà phEhEp Pǃu)F+EE؉GU+V F)ЉGE܉G F+EE؉Gvu'Ã;E~EF)GCG hVhUr RNjF+CC G;UE+F V)‰WE܉G EЋUЋE 9P Eԋ0E@ H~R{C@9CS B9GB9G}!9t CFC F 9t GFEЋUԋB H;E9t CFC F U+@B Ѝe[^_WVS|$W JWH;L }3 ~gGAYYA AY F9w ? ~4G G GЋP X YPQXF9w [^_UWVS u} hh6j$Ép8EC SWv$h6jjC ؍e[^_UWVSu juEpr6uuaEhhF p PUuÃtX PMA u6 S5UB E+Ey@M9A }E+Ey@UB S EPjuuu;ǃ um hhjjjǃ hhjPMHEB 9|E)@BEE+E@BE}u~UB FMA}  uÃtl E0vv WP.ƃU2PMq SRUBhhShhV M1vv WQUB W6@ÃtkPM1vv SQƃE0VUr WPhMAhhSt6hhV E0vv WPUB th%hW h)hjjjE jPhPu h,hM1jUB PMA Ex h/hUBp rÉMQ43GA uKE9x  hPut^ h6hU2jjMA h7hjqËUBBP PDC MA}th>huExt1‹@x u&t"h@hrMAUЍe[^_UWVS(EE 8hPWun}u hPWuJ hPWu,}X hPW6 Wà jhPSVSƃ EPj!SuSEEPjj!S tsEPjj!St^juuE pp ua tu; S jSuuuu u tjuPufuS EPj"SCVS jj"SjS EPhPSVSƍEPjj!S tsEPjj!St^juuE pp uQ tu; S jSuuuu u tjuPuVVS EPj"SH}EjhPSEPj!S uE܃mjWhPutbEPjj!utKEPjj!ut4juuuuu u tjuPuB uEPhPS uE܃jWhPutbEPjj!utKEPjj!ut4juuuuu u tjuPuh ut V}t u Se[^_UVS]utu1 jhhh!h9})@)@uPjVSu u e[^UWVS}hhu$hj Pjƃ } t}u}t u7}u1 jhhh@hhhSF;}} ~EF EF~ju VÉF$h6jjC hhjFpNj^u C }u F@ E}u F@ EE9E~(F@EEGGE+E@G &F@EEGE+E@GG F ju vV e[^_US];t 3]UWVSt$l$N I9}3> ЉF9l}Z Љ9|ωF[^_]UWVSt$l$N I9}3> ЉBF9,~ X9|ωF[^_]UWVS }u EjhPVtEPj!V}tc uÃt_jWhPSt.EPjj!StEPjj!St S WE EPhPS$}t_ uÃt[jWhPSt*EPjj!StEPjj!Sut SE+EEy؉EE SjuuSƃ u^ hzhjjjƃ h{hjP‹EBEB E;E~+E@E+E@B S<$ÃtL jVuPjǃ thhVthhS}tEU}tUEe[^_UWVS8]S SƃEPEPVSÃu VEPuu Sujǃ thhS Vpu/}tEЋU}tE؋U}tE܋UЍe[^_US ]EuuEPuu uƒ t tEЋ]UWVS(]u}EEEEEuu/} x)}x#} u}t;t 3t u]uuu}WVEPuu u hh5 juP;Et=ju5tWVEP76u uË;Eu E;EE u}  }9E ~ 9EUU9U } } u`U 9U} }uLU9U #} yU 9E~(E!}yU9E ~E EEe[^_UWVSuhPVux hPVuZ hPVu< hPVu hPVtG VÃt0 P=ǃu SƉ$ǃ9} Se[^_UVS]EjhPStEPjj!Stue[^UWVSEhhjj05 jPhPutCƒx ~1ƉljЉP9~AF9~9O j5hPutCƒx ~1ƉljЉP9~AF9~9O Ӆ~]Ee[^_UVS EURjPP$ÃtPEPjjSujE puE;E~+uF E+uFthhSe[^ËD$T$+UWVSUB EhhjjPǾ ;u}LhhVW]KJ_D6UBEETF;u|h7*W;u};UZ WYT6]SODF;u|ŅthhWe[^_UWVS]EEhhjjjƃh4PS SEjVh4Pu Vd$!hjjF PEE ~ ~Uh%hPuN XWVP M)ʉPBU9~ }t uth0hVEe[^_UVSu hPVuu" hPV؉؍e[^UWVSu} hAW;]}hCWC;]|jjV EuHR6 PhMW~tWh^WFƒx ~6h_hSRp pp0hdW CV9Z ʃ~tNhrWFx ~/hhhSvp0hxW CF9X у~ t?F ƒx ~/hohSR URW0CV 9Z эe[^_UWVSthAu hu Ep hu Urrhu hu PPPjjUB0 uhu 1  Phu UB0 Phu ju Ep}hu hu jjuuhu Z Shu ~Shu hAu 8Dž~O+UBPhVƃ1KtGFJtKu FJ~Phu lthhhAu e[^_smap.cX2_NO_OVERLAP_EXTERNALINTERNAL_GAPSPERFECT_MAPERROROUTSIDE_AREAX1_NO_OVERLAP_EXTERNALX1_INTERNAL_CLIPNO_OVERLAP_INTERNALX1_EXTERNAL_CLIPX2_EXTERNAL_CLIPX2_INTERNAL_CLIPDNAFailed assertion: (%s)AlignAlignDNAPepAlignPepDNAMismatchS_ChildS_ParentSubsequenceSourcex1 != 0 && x2 != 0Source_exons UpDown***%s orient:%s, map:%d,%d->%d,%d mis:%d,%d sMap->nnnn: sMap->length: %d sMap->root->nnnn: NO ROOT Root: %s [%d,%d] sMapLength = %d sMap dna: NO DNA Length = %d%5d %ssmap != NULL && keyp != NULL && start != NULL && end != NULLkey != KEY_UNDEFINED && !(x1 == 0 && x2 == 0) && !(area1 == 0 && area2 == 0) sMap->area1: %d, sMap->area2: %d (only first 1,000 bases printed)GCC: (GNU) 3.4.3 (csl-sol210-3_4-branch+sol_rpath).symtab.strtab.shstrtab.rel.text.data.bss.rodata.str1.1.rodata.str1.4.comment41 PA %D1+D102D1 ?2P3N&44Z4Wl6p & <r&> V&n,96D YS YcF+bn8~c6~  rc?(X(}X!,]&0)BJ7* XD*b-tow~mes . k,=HV8Qbjr| b9' (2?JT^ku^t '#$B-%   39ESy.\dsmap.c_unameunamestatlstatfstatmknodsMapMapExsMapInvertMaplowestUpperSeghighestLowerSeggetExonMapsMapComposeMapssMapKeyAddsMapAddDNAsMapAddRawDNASMapMapOrdersMapLocalMapExsMapNewInfosMapAddNodegetLengthInternalgetLengthOfChildrensMapAddNeighboursmapToParenthasNoParenthashSet.0getLengthInParentunits.1dnaExonsOrderexonsSortsMapDumpInfo_nuname_xstat_lxstat_fxstat_xmknodsMapMaxsMapKeyInfouAssFinduArrayDestroy_dbgsMapParentsMapMapArraysMapMapsMapInverseMaparrayCopy_dbgsMapIsReversesMapErrorStringsMapConvertsMapUnsplicedMapuArray_dbgsMapKeysuArrayCreate_dbgsMapDNAstr2tagbIndexTagbsCreatebsGetKeydnaRawGetbsDoDestroybsGetDatacomplementBasesMapFindSpanmessAbortOnCrashuMessSetErrorOriginuMessCrashsMapLengthbsMarkbsGetArraybsGotouMessFreearraySortsMapLocalMaphalloc_dbgassInsertbsFindTagbsGetKeyTagsbsPushObjbsFindKey2sMapCreatesMapCreateExhandleHandleCreate_dbghandleAlloc_dbgassHandleCreate_dbgsMapDestroysMapEnclosedBysMapTreeRootsMapTreeCoordsiskeyassReCreate_dbguArrayReCreate_dbgbsKeyaceOutPrintnameWithClasssMapDumpsprintfdnaDecodeChar &&5'M(e)*- . 3 - < E Q [ g |    , . 8c o: : .H M<X=> <!?3@HAeB .A C CL Ab  j . E  F   G 9  ' 8L ,k 2{ H  .  : I.  3 <= Jd  i <s J  < J  . K L KL, S: 8Ms {. :G S8 8w 8 8 OP :- &86>A : 8 . .Q W.k q. . : <J :A R8 <Q : 8' /.W _. <= <= <= <=%>? D<NRcIt?IBBS"K1?FKSRiKx }<?IBBS0K??h m<wR?> <TBBEA\ a<k?> <BBBA/LCLOAwE F  GV W X/E< AFIN SGe kY : 8H Ly! ~!<!R!?!>! !<!T!B!B"A#">;" @"<J"?R"Ak">" "<"B"B"B"A"S#N# $#:3# ;#8s#A# #.# #.!$>T$A$ $.$A%]f%^%^%[% %%_% &P!&&&PB&[&HP' U'<_'=n' s'<}'=' '<'=' '<'=' '<'='>.(A\( a(<k(?(B( ((`(( (<(J(7)?) D)<P)Ja))a!* '*.e* o*:* *8**M1+ 7+.f+ q+:{+ +<+=+>+ +<+J+ +: , 3,8|,A, ,., ,<,=, ,<,=- -b0- 6-bI-4Q- Z- e-cn- t-b- -b- -8- -b- -b. .8. .bH. O.8. .b. .b. .b..b. .b/\/ /btxu xtz u SPhP* uǃtPj<$EPSuƒ S Sh ]S 5EPSVue[^_UVS BuJ hhjj VƃSPt jSVu SKuthhVe[^Can't find the Class entry %s of class %d, this is a programming bug, sorry Further similar warnings suppressedCan't find the Class object for %s:%sMore than 8 eight filters in class %sClass %s cannot find previous mask of %sclass.ctoto__filters%dSorting %s GCC: (GNU) 3.4.3 (csl-sol210-3_4-branch+sol_rpath).symtab.strtab.shstrtab.rel.text.data.bss.rodata.str1.4.rodata.str1.1.comment4!   %X +X 02X ?2E %Nj 4 W p    &>!V'n-9DO|^[hw'38BNUcl '8EP[hpx class.c_unameunamestatlstatfstatmknodnWarnings.0children.1checkLoopsfindInStackcheckFiltersclassSortClass_nuname_xstat_lxstat_fxstat_xmknod_VClasspickClass2Wordlexword2keymessoutuArray_dbguArrayReCreate_dbgkeySetOrderarrayInsertbsCreatebsGetKeyarrayFindbsDoDestroyarrayRemovenameclassNamestackCursorstrcmpstackNextTextpushTextstackHandleCreate_dbgstackTextOnlybsGetDatahalloc_dbgstrcpycondCheckSyntaxuMessFreesprintf_VCalcullexaddkeypickListstackGetuStackDestroybsUpdatebsFindTagbsAddDatabsDoSaveuArrayCreate_dbgqueryIsAInitmessprintfmessStatusbIndexObjectlexNextlexmarkstackStoreclassSortAlluArrayDestroy_dbg 5Me  $5?DI^j u!"# "$%!H"Wd#~"$%&'( -B&Q'Z _()*+,-$,+OZd!./01$22+$HQ3Z4d5s6~7((*)**08E6ep{9."!.:$$3"H;R\r;z<66=66>  %-$B&O&X ]e$m$66?@ ! A( $8 BH CQ Z 3c 4m 5y D 6    Fsysclass.o/ 1133374771 530 202 100644 24208 ` ELF;4( UuUuU u ujU u ujU u ujUuu ujUSj*hjhÃhPh Sh0Sh Sh Sh Sh$Sh Sh=Sh ShTShShSh(ShUShShShShSh(Sh\ShShrShShShShSh ShSh<Sh`Sh ShShShSh(Sh\ShShShShPShShShSh0Sh`Sh ShShSh4ShpShShShShShSh8Sh ShhShSh ShShSh$ ShL Sht Sh Sh Sh Sh0 ShT ShShx Sh Sh Sh, Sh` Sh Sh Sh Sh ShP Sh ShSh2Sht ShGSh Sh Sh Sh Sh$ ShX Sh Sh Sh ShSh4Sh`ShShShShSh@ShhShShShShSh0ShdShShShShSh4Sh\Sh SheSh{ShShShShShShShShSh ShSh/ShBShSShfShxShShShShShShShShShSh,Sh<ShPSh^ShpShSh ShShShShSh,ShXShShShShSh,ShSh ShPShSh ShSh ShS؋]USjjjvjBhjjjhjAhjjjhjAhjjjhjAhjjjHjBhjjjhjAhjjjhjAhjjjvjAh"jjjvjBh)jjjhjAh/jjjhjBh6jjjhjXh=jjjhjXhBjjjhjXhJjjjhjBhRjjjhjAh^jjjHjBhgjjjhjBhmjjjhjAhsjjjhjBhjjjhjBhjjjhjBhjjjhjBhjjjhjAhjjjhjAhjjjhjBhjjjhjAhjjjhjAhjjjhjAhjjjhjAhjjjhjAhjjjhjAhjjjhjAhjjjhjAh ]US hhhh"hh)hh=hhBhhJhhRhh^hhghhmhhshhhhhhhhhhh#hh*hh/hh/hh4h jEPht,M Bu u Ju܉]UShjj hjj hjj hjj hjj$ jEPhE% jEPh"E% jEPh/E% jEPhgE% jEPh)E% jEPh=E% jEPh^E% jEPh9E% jEPhmE% jEPhsE% jEPhE% 5EPhE% jEPhBE% jEPhRE% jEPhE% jEPhE%]U h=jj h?jj hKjj hQjj hYjj h_jj hejj hkjj hqj j hwj j h}j j hj j hj j hjj hjj hjj hjj hjj hjj hjj hjj hjj hjj hjj hjj hjj hjj hjj hjj hjj hjj hj j h#j!j h+j"j h2j(j h9j)j h>j*j hBj+j hGj,j hNj-j hTj2j hYj3j hj4j h^j5j hfj6j hoj7j hyj8j hj9j hj:j hj;j hjj hj?j h9j@j hjAj hjBj hjCj hjDj hjEj hjFj hjGj h.jHj h5jIj hBjJj hOjKj hXjLj hojMj hyjNj hjOj hjPj hjQj hjRj hjSj hjTj hjUj hjVj hjWj hjXj hjYj hjZj hj[j hj\j h'j]j h-j^j h4j_j h>j`j hJjaj hTjbj hajdj hgjej hmjfj hwjgj hjhj hjij hjjj hjkj hjlj hjmj hjnj hjoj hjpj hjqj hjrj hjsj hjtj hjuj hjvj hjwj h jxj h jyj h jzj h j{j h$ j|j h/ j}j h6 j~j h= jj hH hj hM hj hV hj h] hj he hj$ jEPhs jEPh jEPh jEPh jEPh jEPh jEPh jEPh jEPh jEPh jEPh jEPh jEPh jEPh jEPh jEPh jEPh jEPh jEPh jEPh jEPh UWVSDž h juÃd(ƅ 8ƅt 8_uxVt4hFh u Ph|Iv#hJhVh( VV$u)hNh VhtPj S S$ e[^_sysclass.c ?Text Quoted_in ANY ?Comment Quoted_in ANY ?Keyword Quoted_in ANY Composite_of ?Class Mask UNIQUE Int Filter UNIQUE Text Constraints Text Index ?Tag Uses_class ?Class GlobalLex UNIQUE Int ?Table Title UNIQUE Text Comment Text Sortcolumn UNIQUE Int?Colour UNIQUE WHITE BLACK LIGHTGRAY DARKGRAY RED GREEN BLUE YELLOW CYAN MAGENTA LIGHTRED LIGHTGREEN LIGHTBLUE DARKRED DARKGREEN DARKBLUE PALERED PALEGREEN PALEBLUE PALEYELLOW PALECYAN PALEMAGENTA BROWN ORANGE PALEORANGE PURPLE VIOLET PALEVIOLET GRAY PALEGRAY CERISE MIDBLUE Remark ?Text StandAloneDisplay Text?View Type// End of the system models TagSystemGlobalMainClassesSessionVocBatKeySetModelCalculColourTextCommentKeywordUserSessionLongTextClassTableTableResultJadeViewSourceCodeIncludeQueryConstraintDisplayDNAPeptideMatchTableBaseCallcMapgMappMapvMapTREEDtKeySetDtLongTextDtSpreadSheetDtTableResultFMAPPEPMAPCMAPPMAPVMAPImageAddressTextGreekRussianText1Text2Text3_DNA1_DNA2_DNA3_DNA4_DNA5_DNA6_DNA7_RNA1_RNA2_RNA3_RNA4_Protein1_Protein2_Protein3NextCLastCIntUnsignedLongLong_UnsignedFloatDateTypecontinuationKeyLastNbsHerebsRightbsDownUNIQUEXREFANYFREEREPEATCOORDDateUserBatPlusBatMinusGlobalBatSession_TitleSessionLexVocLexGlobalLexQuoted_inCodeReleaseDataReleaseCreated_fromPick_me_to_callFileNon_graphicCentreDestroyed_by_sessionUp_linked_toPermanent_sessionSecretThis_sessionRelated_tagsUsed_forAppears_in_source_codeUses_tagsSourceFileIncludesIncluded_byParent_tagAppears_in_classCompiled_asIs_a_subclass_ofIs_a_superclass_ofUses_classVisibleHiddenMaskBelongs_to_classFilterVisibilityStartFinishPROTECTEDConstraintsFile_nameIndexVersionWHITEBLACKLIGHTGRAYDARKGRAYREDGREENBLUEYELLOWCYANMAGENTALIGHTREDLIGHTGREENLIGHTBLUEDARKREDDARKGREENDARKBLUEPALEREDPALEGREENPALEBLUEPALEYELLOWPALECYANPALEMAGENTABROWNORANGEPALEORANGEPURPLEVIOLETPALEVIOLETGRAYPALEGRAYCERISEMIDBLUELastSystemTag_Global_Bat_lexi1_lexa1_voc1_lexi2_lexa2_voc2_lexi3_lexa3_voc3_batPlus_batMinus_oldPlus_oldMinus_lexh1_lexh2_lexh3_lext2_lext3_lext1_superkeyr#defineNo classClass name %s is too long// Acedb system models, please do not edit. ?Model ANY // must come first ?Class Compiled_as UNIQUE Text UNIQUE Int // Consistency check Belongs_to_class UNIQUE Int Is_a_subclass_of ?Class XREF Is_a_superclass_of UNIQUE Int // the mask of that subclass Is_a_superclass_of ?Class XREF Is_a_subclass_of UNIQUE Text UNIQUE Int //Query and mask Uses_tags ?Tag XREF Appears_in_class Visibility UNIQUE Buried Hidden Visible ID UNIQUE ID_local ID_template UNIQUE Text ID_nametype Text #ID_nametype_qualifiers ID_remote UNIQUE Text UNIQUE Int // host and port Web_location UNIQUE ?WWW_server#ID_nametype_qualifiers Is_unique Is_primary Users_with_write_access Text#ID_history_action Event Created UNIQUE Text UNIQUE Text UNIQUE Text Killed Resurrected Merged_into UNIQUE Text Acquires_merge UNIQUE Text Split_from UNIQUE Text UNIQUE Text UNIQUE Text Split_into UNIQUE Text Add_name UNIQUE Text UNIQUE Text UNIQUE Text Remove_name UNIQUE Text UNIQUE Text UNIQUE Text Imported // the three Texts are // Merged_into, Acquires_merge, Split_into, Split_from use // Add_name, Remove_name use // if is unique then Add_name replaces, as normal in acedb?Tag Parent_tag UNIQUE Text UNIQUE Int // Name and value of Tag for Consistency check Related_tags ?Tag XREF Related_tags Used_for Text Text // Database_name semantics Appears_in_class ?Class XREF Uses_tags Appears_in_source_code ?SourceCode XREF Uses_tags ?SourceCode SourceFile ?LongText Uses_tags ?Tag XREF Appears_in_source_code Includes ?Include XREF Included_by ?Include SourceFile ?LongText Included_by ?SourceCode XREF Includes ?Session Session UNIQUE Int Permanent_session // If set, prevents automatic destruction Date UNIQUE Text User UNIQUE Text Session_Title UNIQUE Text CodeRelease UNIQUE Int UNIQUE Int DataRelease UNIQUE Int UNIQUE Int Created_from UNIQUE ?Session Up_linked_to UNIQUE ?Session Destroyed_by_session UNIQUE Int SessionLex UNIQUE Int UNIQUE Int UNIQUE Int UNIQUE Int VocLex UNIQUE Int UNIQUE Int UNIQUE Int UNIQUE Int GlobalBat UNIQUE Int UNIQUE Int // address # blocks used BatPlus UNIQUE ?Bat UNIQUE Int // # block set BatMinus UNIQUE ?Bat UNIQUE Int // # blocks freed IndexVersion UNIQUE Int // automatic indexing ?Display Visibility // not yet used, but i need a model // i will later turn wspec/displays.wrm into an // ace file Precompute ?TableResult Int // Int is session number Parameters UNIQUE Text Colonne Int #Table_definition#Table_definition Subtitle UNIQUE Text Origin UNIQUE From UNIQUE Int Right_of UNIQUE Int Tag UNIQUE Text Visibility UNIQUE Hidden Visible Width UNIQUE Int Presence UNIQUE Optional Mandatory Null Condition UNIQUE Text Type UNIQUE A_Class UNIQUE Text An_Int A_Float A_Text A_Date Boolean Show_Tag Next_Tag Next_Key UNIQUE Text Extract UNIQUE All Min Max Average Variance Sum Count?UserSession Session UNIQUE ?Session Start UNIQUE DateType Finish UNIQUE DateType User UNIQUE Text // use text Keysets New UNIQUE ?KeySet Touched UNIQUE ?KeySet Deleted UNIQUE ?KeySet Program UNIQUE Client Server tace xace?Jade Display Text Text Text UNIQUE TextClass %s should start by _V in wspec/classes.wrm at line %dThe numerical value of class %s is missing at line %d in wspec/classes.wrm, I quitGCC: (GNU) 3.4.3 (csl-sol210-3_4-branch+sol_rpath).symtab.strtab.shstrtab.rel.text.data.bss.rodata.str1.1.rodata.str1.4.comment4 xC %+02B ?2D' NO;4;W=  DA1 &>$V*n08?GOWr aw  !+1:CKSZemuM (sysclass.c_unameunamestatlstatfstatmknod_nuname_xstat_lxstat_fxstat_xmknodsysModelsstackHandleCreate_dbgpushTextsysClassOptionsREADING_MODELSpickSetClassOptionsysClassDisplayTypespickSetClassDisplayTypelexword2keypickListsysClassInitlexHardDefineKeylexReHashClasslexaddkey_VBat_VKeySet_VCalcul_VClass_VModel_VText_VLongText_VImage_VTable_VTableResult_VJade_VView_VComment_VUserSession_VQuery_VConstraintlexDefineSystemTagsclassHardInitfilopenfreeworduMessSetErrorOriginuMessCrashstrcpyfreeintfreereadfilclose 5Me           ' -5 ;C IQ W_ em s{            # )1 7? EM S[ ai ow }            %- 3; AI OW ]e ks y             !) /7 =E KS Ya go u}             % +3 9A GO U] ck qy            ! '/ 5= CK QY _g mu {            #+ 19 ?G MU [c iq w             ' -5 ;C IQ W_ em s{               #  ) 1  7 ?  E M  S [  a i  o w  }                     0  5 E  J Z  _ o  t                   ,  1 A  F V  [ k  p                   (  - =  B R  W g  l |                      #  (  - 5  :  ? G  L  Q Y  ^  c k  p  u }                            $ )1 6 ;C H MU Z _g l q     " +7E J W!e j w"  #  $  %  &  '% * 7(E J W)e j w*  +,  ,  -  .   /) . ;0AT ]e nv            )1 :B KS \d mu ~          (0 9A JR [c lt }           '/ 8@ IQ Zb ks |           &. 7? HP Ya jr {           %- 6> GO X` iq z           $, 5= FN W_ hp y           #+ 4< EM V^ go x          %- 9A MU ai u                ' , : ? M R ` e s x                 0<E O3l4{ 4 5  6 5 6(768J O5^ c69:tags.o/ 1133374772 530 202 100644 51456 ` ELFJ4( UuUuU u ujU u ujU u ujUuu ujU jhh jhh jhh" jhh* jhh7 jhh? jhhH jhhP jhhX jhhe jhhl jhh jhh jhh jhh jhh jhh jhh jhh jhh jhh jhh jhh jhh jhh  jhh jhh' jhh+ jhh< jhh@ jhhE jhhS jhhc jhhs jhh jhh jhh jhh jhh jhh jhh jhh jhh jhh jhh jhh jhh jhh jhh, jhh4 jhh= jhhE jhhM jhhb jhhp jhhy jhh jhh jhh jhh jhh jhh jhh jhh jhh jhh jhh jhh  jhh jhh jhh* jhh. jhh8 jhhA jhhM jhhd jhhu jhh| jhh jhh jhh jhh jhh jhh jhh jhh jhh jhh jhh jhh jhh jhh  jhh jhh& jhh; jhhB jhhF jhhO jhh[ jhhd jhhi jhhv jhh jhh jhh jhh jhh jhh jhh jhh jhh jhh jhh jhh jhh jhh  jhh jhh jhh& jhh. jhh= jhhF jhhX jhha jhhi jhhx jhh~ jhh jhh jhh jhh jhh jhh jhh jhh jhh jhh jhh jhh jhh jhh jhh  jhh jhh jhh" jhh) jhh1 jhh: jhhB jhhK jhhT jhhZ jhhb jhhj jhhr jhhz jhh jhh jhh jhh jhh jhh jhh jhh jhh jhh jhh jhh jhh jhh jhh jhh jhh jhh' jhh. jhh6 jhh= jhhB jhhQ jhh` jhho jhhy jhh jhh jhh jhh jhh jhh jhh jhh jhh jhh jhh jhh jhh jhh jhh jhh jhh$ jhh* jhh5 jhh> jhhF jhhP jhhX jhhi jhhs jhhy jhh jhh jhh jhh jhh jhh jhh jhh jhh jhh jhh jhh jhh jhh% jhh0 jhh: jhhD jhhI jhhM jhh[ jhhk jhh{ jhh jhh jhh jhh jhh jhh jhh jhh jhh jhh jhh jhh jhh jhh! jhh' jhh+ jhh1 jhh? jhhH jhhV jhhe jhhs jhh~ jhh jhh jhh jhh jhh jhh jhh jhh jhh jhh jhh jhh jhh jhh jhh jhh jhh# jhh* jhh= jhhO jhhY jhhe jhhq jhhu jhh~ jhh jhh jhh jhh jhh jhh jhh jhh jhh jhh jhh jhh jhh jhh" jhh7 jhh< jhhC jhhJ jhhV jhhg jhho jhhz jhh jhh jhh jhh jhh jhh jhh jhh jhh jhh jhh jhh jhh jhh jhh jhh jhh jhh$ jhh1 jhh< jhhE jhhJ jhhX jhhd jhhp jhhv jhh{ jhh jhh jhh jhh jhh jhh jhh jhh jhh jhh jhh jhh jhh jhh jhh jhh jhh jhh jhh jhh" jhh+ jhh1 jhh: jhhG jhhQ jhhV jhha jhhi jhhw jhh jhh jhh jhh jhh jhh jhh jhh jhh jhh  jhh jhh jhh' jhh3 jhhG jhhQ jhh_ jhhl jhh} jhh jhh jhh jhh jhh jhh jhh jhh jhh jhh jhh jhh jhh jhh jhh  jhh jhh jhh. jhh: jhh? jhhG jhhR jhh] jhhe jhht jhh jhh jhh jhh jhh jhh jhh jhh jhh jhh  jhh jhh jhh- jhh= jhhL jhh[ jhhd jhhm jhhu jhh~ jhh jhh jhh jhh jhh jhh jhh jhh jhh jhh jhh jhh jhh jhh  jhh jhh jhh$ jhh- jhh2 jhh9 jhh@ jhhE jhhK jhhT jhh] jhhh jhhv jhh jhh jhh jhh jhh jhh jhh jhh jhh jhh jhh jhh jhh  jhh jhh jhh% jhh( jhh1 jhhD jhhV jhh_ jhhm jhhu jhh jhh jhh jhh jhh jhh jhh jhh jhh jhh jhh jhh jhh jhh  jhh jhh jhh) jhh5 jhh< jhhI jhhS jhh\ jhhd jhhq jhh jhh jhh jhh jhh jhh jhh jhh jhh jhh jhh jhh jhh jhh jhh jhh jhh jhh0 jhh4 jhh8 jhhG jhhP jhhX jhhp jhh jhh jhh jhh jhh jhh jhh jhh jhh jhh jhh$ jhh0 jhhB jhhM jhh\ jhhp jhh{ jhh jhh jhh jhh jhh jhh jhh jhh jhh jhh jhh jhh jhh jhh jhh jhh& jhhA jhh4 jhh< jhhH jhhQ jhh[ jhhd jhhn jhh{ jhhp jhh jhh jhh jhh jhh jhh jhh jhh jhh jhh jhh jhh jhhUSjEPhPE% jEPh~ E% jEPhE% jEPh*E% jEPh$E% jEPhE% jEPhE% jEPhE% jEPhE% jEPhE% jEPhTE% jEPh E% jEPheE% jEPhE% jEPhE% jEPhE% jEPhE% jEPhE% jEPh E% jEPhE% jEPh E% jEPh E% jEPhE% jEPhdE% jEPhE% jEPhE% jEPh,E% jEPh8E% jEPhGE% jEPhE% jEPhE% jEPhOE%]1_does_not_include_21_includes_22_pointA1_labellingA_non_BAbstractAddressAlignedAligned_intoAlleleAllele_designationAlu_segmentAmberApproximate_Match_toAssembly_repeatAssembly_tagsAce_mbly_tagsAuthorAutoposB_non_ABack_oneBackcrossBalancesBandsBitnetBrief_identificationCDSCDS_predicted_byCGCCalcCalc_distanceCalc_lower_confCalc_upper_confCalculationCalculation_1Calculation_2Canon_for_cosmidCanonical_forChromosomeCleavageCloneSubcloneClone_as_locusClone_insideClone_outsideCloning_vectorCodingCold_sensitiveColumnsCombinedCommentCompanyComplementation_dataComplex_mixedCompoundCompressionContained_inContainsContentsContigContig9ContiguousCorrect_nameCorresponding_DNACorresponding_peptideCosmid_gridCosmid_vectorCoversDB_remarkDB_searchedDNADNA_homolDeletionDescriptionDesignating_laboratoryDetection_methodDf_DupDirectDisplayDistanceDoes_not_hybridize_toDom_letDom_oneDom_selectedDom_semiDominantDuplicationE_mailEnd_not_foundErrorError_scaleExact_Match_toExperimentExpression_constructExtentFaxFeaturesFingerPrintFinishedFlagFloat_ParamsFree_dupFreezerFromFrom_AuthorFrom_LaboratoryFrom_LibraryFrom_left_endFrom_mapFullFull_nameFunctionFunny_Match_toGel_NumberGel_lengthGeneGene_classGene_classesGeneralGeneral_remarkGeneticsGenomic_CanonicalGenotypeGriddedHeat_sensitiveHomolHybrid_cell_lineHybridizes_toIn_SituIn_poolInheritsInsideInt_ParamsInternetIntervalInvertedIsolationIsoschizomersJournalKeywordLaboratoryLayoutLeftLengthLibraryLines_atLinkageLiquidN2LocationLocusLocus_1Locus_2Locus_ALocus_BLoopMailMalesMapMapperMapping_dataMaps_withMarker_locusMatching_GenomicMatching_cDNAMaternalMaxMinMin_scoreMinus70Molecular_informationMulti_pointMultipletMuscleMutagenN_gapsNameNegative_cloneNegative_locusNegative_probeNick_nameNo_overlapNo_staggerOffsetOld_CGC_distanceOld_CGC_resultsOligoOne_allOne_letOne_recombinantOriginOther_nameOutsideOverhangOverlapPCR_productPCR_remarkPagePaperParametersPaternalPatternPep_homolPeptidePercent_IdentityPhenotypePhonePolymorphismPositionPositive_clonePositive_locusPositive_pool_probePositive_probePossible_exonPrecursorPrimersProcedureProcessed_mRNAProductPropertiesProtocolPseudogenePublisherQualifierRFLPRNARearrangementRearrangement_1Rearrangement_2RecessiveRecs_allReferenceReference_AlleleReference_strainRefers_toRejectedRejected_fromRejected_ReadsRelated_SequenceRemarkRepeatsRepresentativeResultsRightRowScoreSearch_MethodSelectedSelected_lociSelected_transSemi_dominantSeq_lengthSequenceSequencing_vectorSex_cisSex_fullSex_oneShotgunSignificant_basesSimilaritySiteSourceSource_ExonsSpace_atSpeciesStaffStart_not_foundStatusStopStrainStrain_designationStrictly_MaternalStructureSubsequenceTATA_signalTSLTSL_siteTandemTemperatureTemperature_sensitiveTestedText_ParamsTitleTo_right_endTrace_qualityExcellent_uptoGood_uptoFair_uptoTranscriptTranslocationTransposonTransposon_insertionTypeType_1Type_2Unit_LengthUnprocessed_mRNAVariantVariant_ofVaxmapVectorVersionVolumeWeakWell_orderedWith_Maternal_EffectY_remarkYearcDNAmRNAMat_peptideMisc_featureMisc_signalModified_baseMutationOld_sequencepMappolyA_signalpolyA_sitePromoterrRNARepeat_regionRepeat_unitSig_peptidesnRNAtRNAA_RepeatNoteSubpoolColourORFATGSplice3Splice5Coding_segForeign_ReferenceVirtual_rowIn_gridChrom_BandCentromereDarkNORInherits_fromFateLineageParentDaughterGroupIn_groupGroup_memberNeurodataSendSend_jointReceiveReceive_jointGap_junctionContactLineage_nameEquivalence_fateEquivalence_originEmbryo_division_timeClone_left_endClone_right_endDerived_fromDerivativeIsolated_forWormpepReplacesReplaced_byConfidential_remarkSubmittedOverlap_rightOverlap_leftRepeat_consensuscDNA_ESTArchivedLethalHand_fixedBalancerRegionHand_verifiedYACCytogeneticInside_YACInside_FragmentBibliographyLinksLinkChimericNon_ChimericSizeInterval_MappingMain_MarkerEndsMappingp_Telomereq_TelomereDrawingMulti_PositionDoes_not_ContainContained_LocusExterior_LocusInside_RearrOutside_RearrOverlapsDoes_not_OverlapNo_Overlap_RearrOverlapping_RearrContained_RearrEmailFlippedAssembled_as_dummyPrevious_contigAssembled_fromAssembled_intoProposedBaseCallGeneticPhysicalRestriction_EnzymeAAClone_GridDf_Dup_dataFragmentPagesMedline_IDLab_LocationMatchMethodMotifMultiMapMulti_countsMulti_pt_dataPoolUnpublishedEC_enzymeDocumentUnitEnzymeGDB_idOMIMProbeATCC_refAdd_dateAnnotationApproval_dateApprovedAssign_modeAvailabilityCSCosmid_clonesCreatedCurrent_symbolCytogenetic_locationDNA_typeData_sourceEC_refEditing_DateExcision_DataGDBGenBank_refHGML_refKWLinks_toMax_heterozygosityModification_dateModifiedOMIM_documentOld_NumOriginatorPolymorphism_DataPrevious_symbolVector_typePrimerSCF_FilePCRCorNeighboursCommon_bandsBand_ValuesSegment_LengthsFragment_ofABIWild_typeABI_DateABI_CommentABI_MachineSampleABI_AnalysisRun_StartRun_StopClippedOld_ClippingHand_ClippingVector_ClippingClippingSymbolAnchorBandGelBand_LengthsOttoMain_LocusSTSSELFChecked_individuallyOutside_YACSTS_outAluPCRby_AluPCR_Hybridisationby_Finger_PrintingKpnTHESomatic_hybridGenethonRoute_2Inside_YAC_Not_VerifiedLocus_Not_VerifiedPossibly_Contains_LocusPossibly_Inside_YACLocus_OutAllelic_VariantsClinical_SynopsesCross_ReferencesDiagnosisEvolutionHistorical_InformationIndex_TermsLast_EditedLocus_DescriptionMIM_NumberOld_MIM_NumberPopulation_GeneticsReferencesTreatmentMain_TextAnimal_ModelsMap_locationMap_errorLongTextPCR_dataClone_dataOligo_DNAAllelepAllelemGametepGametemTetradCentromere_segregationGenetic_codeLethal_testedUsed_inAction_typeInternalAce_queryAce_dumpName_dumpTace_commandExternalAction_elementParamsNo_report_statusRead_aceSynchroImport_keysetHomologyDocPairwiseFuzzySMAPS_ParentProteingMapvMap2_point_dataBaseQualityBasePositionOligoRepeatHomology_groupMap_setPersonIntragenic_revertant_of_dominantGCC: (GNU) 3.4.3 (csl-sol210-3_4-branch+sol_rpath).symtab.strtab.shstrtab.rel.text.data.bss.rodata.str1.1.rodata.str1.4.comment41 9 %1+1021V?2J!N9J4mJW|L@'  s,&> V&n,4;CKS,[q{*9HPYblw$6EQ[bl| "0:DLUao&.6?I`ir ",2@JSYfw $7AJZas *28@IS\fpw "+BOZbksy  ! ) 5 > H Q ^ j p w              + : E N Y i r ~              * 5 ? N ^ p x               & 0 9 B U a g o }               ! . E M Z a o ~           +3;DLR`v  -:AGQW`hmr{ +6<HQ`nw *?JYgy $*<IOXdpy+2;L\lv,2?JTZbjpw $,:IN[eis !/<MZ_jt #)5:@Vclt)4FYkv(6AKUalu~(2<LTfpyi-" &.5>IXhp}tags.c_unameunamestatlstatfstatmknod_nuname_xstat_lxstat_fxstat_xmknodtagInit_1_does_not_include_2lexaddkey_1_includes_2_2_point_A1_labelling_A_non_B_Abstract_Address_Aligned_Aligned_into_Allele_Allele_designation_Alu_segment_Amber_Approximate_Match_to_Assembly_repeat_Assembly_tags_Ace_mbly_tags_Author_Autopos_B_non_A_Back_one_Backcross_Balances_Bands_Bitnet_Brief_identification_CDS_CDS_predicted_by_CGC_Calc_Calc_distance_Calc_lower_conf_Calc_upper_conf_Calculation_Calculation_1_Calculation_2_Canon_for_cosmid_Canonical_for_Chromosome_Cleavage_Clone_Subclone_Clone_as_locus_Clone_inside_Clone_outside_Cloning_vector_Coding_Cold_sensitive_Columns_Combined_Comment_Company_Complementation_data_Complex_mixed_Compound_Compression_Contained_in_Contains_Contents_Contig_Contig9_Contiguous_Correct_name_Corresponding_DNA_Corresponding_peptide_Cosmid_grid_Cosmid_vector_Covers_DB_remark_DB_searched_DNA_DNA_homol_Deletion_Description_Designating_laboratory_Detection_method_Df_Dup_Direct_Display_Distance_Does_not_hybridize_to_Dom_let_Dom_one_Dom_selected_Dom_semi_Dominant_Duplication_E_mail_End_not_found_Error_Error_scale_Exact_Match_to_Experiment_Expression_construct_Extent_Fax_Features_FingerPrint_Finished_Flag_Float_Params_Free_dup_Freezer_From_From_Author_From_Laboratory_From_Library_From_left_end_From_map_Full_Full_name_Function_Funny_Match_to_Gel_Number_Gel_length_Gene_Gene_class_Gene_classes_General_General_remark_Genetics_Genomic_Canonical_Genotype_Gridded_Heat_sensitive_Homol_Hybrid_cell_line_Hybridizes_to_In_Situ_In_pool_Inherits_Inside_Int_Params_Internet_Interval_Intragenic_revertant_of_dominant_Inverted_Isolation_Isoschizomers_Journal_Keyword_Laboratory_Layout_Left_Length_Library_Lines_at_Linkage_LiquidN2_Location_Locus_Locus_1_Locus_2_Locus_A_Locus_B_Loop_Mail_Males_Map_Mapper_Mapping_data_Maps_with_Marker_locus_Matching_Genomic_Matching_cDNA_Maternal_Max_Min_Min_score_Minus70_Molecular_information_Multi_point_Multiplet_Muscle_Mutagen_N_gaps_Name_Negative_clone_Negative_locus_Negative_probe_Nick_name_No_overlap_No_stagger_Offset_Old_CGC_distance_Old_CGC_results_Oligo_One_all_One_let_One_recombinant_Origin_Other_name_Outside_Overhang_Overlap_PCR_product_PCR_remark_Page_Paper_Parameters_Paternal_Pattern_Pep_homol_Peptide_Percent_Identity_Phenotype_Phone_Polymorphism_Position_Positive_clone_Positive_locus_Positive_pool_probe_Positive_probe_Possible_exon_Precursor_Primers_Procedure_Processed_mRNA_Product_Properties_Protocol_Pseudogene_Publisher_Qualifier_RFLP_RNA_Rearrangement_Rearrangement_1_Rearrangement_2_Recessive_Recs_all_Reference_Reference_Allele_Reference_strain_Refers_to_Rejected_Rejected_from_Rejected_Reads_Related_Sequence_Remark_Repeats_Representative_Results_Right_Row_Score_Search_Method_Selected_Selected_loci_Selected_trans_Semi_dominant_Seq_length_Sequence_Sequencing_vector_Sex_cis_Sex_full_Sex_one_Shotgun_Significant_bases_Similarity_Site_Source_Source_Exons_Space_at_Species_Staff_Start_not_found_Status_Stop_Strain_Strain_designation_Strictly_Maternal_Structure_Subsequence_TATA_signal_TSL_TSL_site_Tandem_Temperature_Temperature_sensitive_Tested_Text_Params_Title_To_right_end_Trace_quality_Excellent_upto_Good_upto_Fair_upto_Transcript_Translocation_Transposon_Transposon_insertion_Type_Type_1_Type_2_Unit_Length_Unprocessed_mRNA_Variant_Variant_of_Vaxmap_Vector_Version_Volume_Weak_Well_ordered_With_Maternal_Effect_Y_remark_Year_cDNA_mRNA_mat_peptide_misc_feature_misc_signal_modified_base_mutation_old_sequence_pMap_polyA_signal_polyA_site_promoter_rRNA_repeat_region_repeat_unit_sig_peptide_snRNA_tRNA_A_Repeat_Note_Subpool_Colour_ORF_ATG_Splice3_Splice5_Coding_seg_Foreign_Reference_Virtual_row_In_grid_Chrom_Band_Centromere_Dark_NOR_Inherits_from_Fate_Lineage_Parent_Daughter_Group_In_group_Group_member_Neurodata_Send_Send_joint_Receive_Receive_joint_Gap_junction_Contact_Lineage_name_Equivalence_fate_Equivalence_origin_Embryo_division_time_Clone_left_end_Clone_right_end_Derived_from_Derivative_Isolated_for_Wormpep_Replaces_Replaced_by_Confidential_remark_Submitted_Overlap_right_Overlap_left_Repeat_consensus_cDNA_EST_Archived_Lethal_Hand_fixed_Balancer_Region_Hand_verified_YAC_Cytogenetic_Inside_YAC_Inside_Fragment_Bibliography_Links_Link_Chimeric_Non_Chimeric_Size_Interval_Mapping_Main_Marker_Ends_Mapping_p_Telomere_q_Telomere_Drawing_Multi_Position_Does_not_Contain_Contained_Locus_Exterior_Locus_Inside_Rearr_Outside_Rearr_Overlaps_Does_not_Overlap_No_Overlap_Rearr_Overlapping_Rearr_Contained_Rearr_Email_Flipped_Previous_contig_Assembled_from_Assembled_into_Proposed_BaseCall_Genetic_Physical_Restriction_Enzyme_AA_Clone_Grid_Df_Dup_data_Fragment_Pages_Medline_ID_Lab_Location_Match_Method_Motif_MultiMap_Multi_counts_Multi_pt_data_Pool_Unpublished_EC_enzyme_Document_Unit_Enzyme_GDB_id_OMIM_Probe_ATCC_ref_Add_date_Annotation_Approval_date_Approved_Assign_mode_Availability_CS_Cosmid_clones_Created_Current_symbol_Cytogenetic_location_DNA_type_Data_source_EC_ref_Editing_Date_Excision_Data_GDB_GenBank_ref_HGML_ref_KW_Links_to_Max_heterozygosity_Modification_date_Modified_OMIM_document_Old_Num_Originator_Polymorphism_Data_Previous_symbol_Vector_type_Primer_SCF_File_PCR_Cor_Neighbours_Common_bands_Band_Values_Segment_Lengths_Fragment_of_ABI_Wild_type_ABI_Date_ABI_Comment_ABI_Machine_Sample_ABI_Analysis_Run_Start_Run_Stop_Clipped_Old_Clipping_Hand_Clipping_Vector_Clipping_Clipping_Symbol_Anchor_Band_Gel_Band_Lengths_Otto_Main_Locus_STS_SELF_Checked_individually_Outside_YAC_STS_out_AluPCR_by_AluPCR_Hybridisation_by_Finger_Printing_Kpn_THE_Somatic_hybrid_Genethon_Route_2_Inside_YAC_Not_Verified_Locus_Not_Verified_Possibly_Contains_Locus_Possibly_Inside_YAC_Locus_Out_Allelic_Variants_Clinical_Synopses_Cross_References_Diagnosis_Evolution_Historical_Information_Index_Terms_Last_Edited_Locus_Description_MIM_Number_Old_MIM_Number_Population_Genetics_References_Treatment_Main_Text_Animal_Models_map_location_map_error_LongText_PCR_data_Clone_data_Oligo_DNA_Allelep_Allelem_Gametep_Gametem_Tetrad_Centromere_segregation_Genetic_code_Lethal_tested_description_used_in_action_type_internal_ace_query_ace_dump_name_dump_tace_command_external_compound_action_element_params_no_report_status_read_ace_synchro_import_keyset_Homology_Doc_Pairwise_Fuzzy_SMAP_S_ParentclassInitREADING_MODELS_VPeptide_VSequence_VProtein_VDNA_VPaper_VMethod_VMap_VgMap_VvMap_VMultiMap_VLocus_VGene_VAllele_VInterval_V2_point_data_VMulti_pt_data_VClone_VClone_Grid_VPool_VContig_VpMap_VChrom_Band_VMotif_VBaseCall_VBaseQuality_VBasePosition_VOligoRepeat_VHomology_group_VMap_set_VDoc_VGenetic_code_VPerson_Assembled_as_dummy 5Me        # (27 <FK PZ_ dn s x! " # $ % & ' ( ")' ,6*; @J+O T^,c hr-w |. / 0 1 2 3 4 5 &6+ 0:7? DN8S Xb9g lv:{ ; < = > ? @ A B *C/ 4>DC HREW \fFk pzG H I J K L M N  O $.P3 8BQG LVR[ `jSo t~T U V W X Y Z  [ \# (2]7 <F^K PZ__ dn`s xa b c d e f g h "i' ,6j; @JkO T^lc hrmw |n o p q r s t u &v+ 0:w? DNxS Xbyg lvz{ { | } ~         * /  4 > C  H R W  \ f k  p z                            $ . 3  8 B G  L V [  ` j o  t ~                          #  ( 2 7  < F K  P Z _  d n s  x                           " '  , 6 ;  @ J O  T ^ c  h r w  |                           & +  0 : ?  D N S  X b g  l v {                      */ 4>C HRW \fk pz          $.3 8BG LV[ `jo t~         # (27 <FK PZ_ dns x        "' ,6; @JO T^c hrw |        &+ 0:? DNS Xbg lv{         */ 4>C HRW \fk pz               $.3 8BG LV[ `jo t~         # (27 <FK PZ_ dn s x! " # $ % & ' ( ")' ,6*; @J+O T^,c hr-w |. / 0 1 2 3 4 5 &6+ 0:7? DN8S Xb9g lv:{ ; < = > ? @ A B *C/ 4>DC HREW \fFk pzG H I J K L M N  O $.P3 8BQG LVR[ `jSo t~T U V W X Y Z  [ \# (2]7 <F^K PZ__ dn`s xa b c d e f g h "i' ,6j; @JkO T^lc hrmw |n o p q r s t u &v+ 0:w? DNxS Xbyg lvz{ { | } ~     */ 4>C HRW \fk pz          $.3 8BG LV[ `jo t~         # (27 <FK PZ_ dns x            " '  , 6 ;  @ J O  T ^ c  h r w  |                    ! !!! !&!+! 0!:!?! D!N!S! X!b!g! l!v!{! !!! !!! !!! !!! !!! !!! !"" """ "*"/" 4">"C" H"R"W" \"f"k" p"z"" """ """ """ """ """ """ "# # ### $#.#3# 8#B#G# L#V#[# `#j#o# t#~## ### ### ### ### ### ### $ $$ $$#$ ($2$7$ <$F$K$ P$Z$_$ d$n$s$ x$$$ $$$ $$$ $$$ $$$ $$$ $$$ %%% %"%'% ,%6%;% @%J%O% T%^%c% h%r%w% |%%% %%% %%% %%% %%% %%% %%& &&& &&&+& 0&:&?& D&N&S& X&b&g& l&v&{& &&& &&& &&& &&& &&& &&& &'' ''' '*'/' 4'>'C' H'R'W' \'f'k' p'z'' ''' ''' '' ' '' ' '' ' '' ' '(  ( ((( $(.(3( 8(B(G( L(V([( `(j(o( t(~(( ((( ((( ((( ((( ((( ((( ) )) ))#) ()2)7) <)F)K) P)Z)_) d)n)s) x)) ) ))!) ))") ))#) ))$) ))%) ))&) **'* *"*('* ,*6*);* @*J**O* T*^*+c* h*r*,w* |**-* **.* **/* **0* **1* **2* **3+ ++4+ +&+5++ 0+:+6?+ D+N+7S+ X+b+8g+ l+v+9{+ ++:+ ++;+ ++<+ ++=+ ++>+ ++?+ +,@, ,,A, ,*,B/, 4,>,CC, H,R,DW, \,f,Ek, p,z,F, ,,G, ,,H, ,,I, ,,J, ,,K, ,,L, ,-M - --N- $-.-3- 8-B-OG- L-V-P[- `-r-Rx-R- --S- --T- --U- --V. ..W'. ,.9.XG. L.Y.Yg. l.y.Z. ..[. ..\. ..]. ..^/ //_'/ ,/9/`G/ L/Y/ag/ l/y/b/ //c/ //d/ //e/ //f0 00g'0 ,090hG0 L0Y0ig0 l0y0j0 00k0 00l0 00m0 00n1 11o'1 ,191pG1 L1Y1qg1 l1y1r1Rmodel.o/ 1133374773 530 202 100644 19300 ` ELF(4( UuUuU u ujU u ujU u ujUuu ujáT$D$UWVS5EPhhhjǻx ~TjghSW0ƃt*j\Pt V VC9_ ƀKue[^_UE? uu ut P uEP5uUWVS,EEEEEEEE==ƃjPjh% u1 hSh'5 $ VÃuσ 5 t Vh+5 $ P5 Ph<s jh+h-h1h8à t h+P$ =uPhlhhjj@$hjjj hhjP E@ E@ \u] :y 5 ؉EB ىM@BE@0$EEuMEz8y 5EB]@B}t} t @ tEEEE e\t}"u }E}}Eƒx ~ ыUQ}9<} EЉʋE9A U9P tPM9 ~+hh u5 h}Ћ] ;hhu5UEЃ5EEM̈MEP5}X}Nhhj5Ã8@C;"u C;tэD8"u 55EPh>5hhuuPS8?t8#ub CPƃtMh huuр;#u Vu>VEPj*jh%huuPSEEE}uB @  P=t%h9h5=t 5=u* 5    e[^_UWVS5EPhhhjǃp Nh[hVW0ÃtfjTPt Sj[St SjYSt S SNi jh+h-hKh8à t7jhh+PtjPt Se[^_USE> uÃt*j`Pt S SEP5u]UVS jh+h-hVh8à t6jhh+PƉ$tjVe[^UVSu~t v~t vV~~%tt:n v PhbS 5FPS6 v PhfS 5FPSe[^UVSDžV 8#u@@PhbV 5PVtjjVP5ue[^UVSu;to5EPR$uÃpvCUPsCp(K$$e[^UWVS }u W~L%w@ R Phbh vPh t  G;FtCt!~tvwpu C C~t!~tvwBu C C~e[^_UWVSEEu h jE$qhjjjƃhrhjjjE hshjhhjP~ E%f}t7hh 5 uPh}tA uUruMI$ $uEEE PEu%5 uPhHUZCÉVGCEhhEP@Eur}~ MA ;E}5 hpIUBECÉVGChhEP@Eu9~ ~?CÉVGChhEP@Eu9~ EUB EPV}tA MquzEH$$uu|}thhuthhV=t 5G j=t3Ãp hpthhSU܉e[^_Uh=tmt& htU j ht/uhh4 ËT$u:_u#tBu:_tݸ:uUWVS }] u=(t({(uI{t WPh\{ WPh{,uI{t WPh{J WPh+{-uU{t WPh,xx WPh`C;up=(ug{t) W PsPh{ W PsPhT{*u{} hhC; PEPs$C;E{t) W PsPhP{t) W PsPh sƃu+ W PsPh>@xu) W PsPh VL{v{t 6 sPu) W PsPh(u) W PsPhXjCPut+ W PsPh}{tCx(u!xujCPuMCx(t @PCPu$C@@PCPu{Cx)AC;t1;t) W PsPhCxt) W PsPhCxt@xuxw. W PsPhC@xt) W PsPhPhh$p P‰8x(u @B@BCBC@@B CX{to[{tL{v{t) W PsPhuVSW-[uuVSW e[^_UWVS(h hjjj EhhjjhEhhjjh$ E փ VhhEp P04$E@xtJhhjhhWu( SjEpV uG 596$ƒx Bsh.h%PuEPC PR V Ps Ps$ s Ps P3Ph Q VPs$ s Ps P3Ph( G$9z ;Et h[hOhWu8t?hOhWu0hOhWuG 59=$t%hPh5$$}thQhuEe[^_UWVS ] u{)u[[{(u [{{,qhhhjE;}uEE8{uK{vEhqhusPhPECE}u/hwhu FPhPES~>hyhuFPuPhPE uEFC{u PǃC Au6hhusPhPǃSC%u6hhusPhfPǃ sǃC;u,us@$uE0hu uWuE0hu VuuMQsui[ t E}t ue[^_USu @$$Ãt+EjjEPjsuS]ClassFind Class Visibilitymodel.cw%s rwrmmodelswspec(NULL Query)subclassesconstraints?%s#%sdummyRead models got %d modelsre-read the modelsI cannot update the models.Errors in model fileNAMEEXISTS %s[%d]%s[%d]@%s%d %d |#%s|%s| %d %d |%s|%s| Cannot continue without creating temporary sysmodel file!Cannot reopen temporary sysmodel file %s (%s)Cannot open model file : wspec/models.wrm (%s)Model file: tree screwup line %d level %dFIND Class Is_a_subclass_of OR Filter OR MaskSorry, you do not have Write Access%s starts line but not new class at line %dCan not form model for %s at line %dModel screwup: impossible level line %dYou did not save the current session: should I ?Watch out ! An erroneous modification of the models may screw up the system. Do you want to proceed?Sorry, you cannot gain write access. Model error: DOWN from UNIQUE in model %sModel error: UNIQUE in model %s with nothing to the rightModel error: something right of REPEAT in model %sModel error: something down from REPEAT in model %sModel error: something down from COORD in model %sModel error: COORD not preceeded by Int or Float in model %sModel error: something right of attach query %s in model %sModel error: something down from attach query %s in model %sModel error: ANY with something DOWN in model %sModel error: something right of subtype %s in model %sModel error: something down from subtype %s in model %sModel error: no model for subtype %s in model %sModel error: empty model for subtype %s in model %sModel error: invalid tag name %s in model %sModel error: tag %s outside rooted subtree in model %sModel error: duplicate tag %s in model %sModel error: XREF from %s not a class in model %sModel error: DOWN from XREF %s in model %sModel error: no tag after XREF from %s in model %sModel error: down from tag after XREF from %s in model %sModel error: non-tag %s in column in model %sModel error: In model %s, tag %s XREF's to tag %s in class %s can't find tag %s in model %sModel error: In model %s, tag %s XREF's to tag %s in class %s can't find model %sc{GCC: (GNU) 3.4.3 (csl-sol210-3_4-branch+sol_rpath).symtab.strtab.shstrtab.rel.text.data.bss.rodata.str1.1.rodata.str1.4.rel.rodata.comment4 : %+, 02 ?2 R'N I ZX(4(c* ) 3< &>!V'n-@CSh}bio ~Y >K q nh 0   V  BT!J.G;(B$H Yahpx !)1;GT]my,7BJX`gq)4>E8 !R`hq $4Y?P\fs  ]\-model.c_unameunamestatlstatfstatmknodmodelChangeRoutines1cleanVisibilitycleanOldModelspass.0fil.1tmp_sysmodel.2levelCount.3sword.4getLinelinegetSubClassesremoveConstraintsgetConstraintscleanUpModelsaliasModelsduplicateModelbuf.5treeComparecheckModelSyntaxdepthvalidTagnamecheckRecurseatRootxinfoshowModelNodeJaq_nuname_xstat_lxstat_fxstat_xmknodmodelChangeRegisterisModel_VClasslexword2keyqueryParametrizeduArray_dbgbsUpdatebsFindTagbsRemovebsDoSavepickListREADING_MODELSiskeybsDoKilllexkill_VModellexNextsysModelsstackCursoraceTmpCreatemessExitaceTmpGetOutputaceOutPrintstackNextTextaceTmpCloseuStackDestroyaceTmpGetFileNamefopenmessSysErrorTextdbPathStrictFilNameuMessFreestackHandleCreate_dbguArrayCreate_dbg__filbufuMessSetErrorOriginuMessCrashstackClearcatTextstackText_dbg_VQuerylexMaxlexaddkeypickMakeClassfcloseuArrayDestroy_dbguAceTmpDestroyaceInCreateFromFileparseAceInProtectedqueryClearConstraintspickRegisterConstraintsclassNamesprintfnamelexAliasbsTreePrunebsTreeCopycacheMarkstrcmpgetNewModelsisWriteAccessmessoutpickInitpickGetClassPropertiessysClassDisplayTypesmesscrashroutinesimpleCrashRoutinesysClassOptionspushTextbsKeybsMakePathsBSallocpickCheckConsistencylexAlphaClassListmessdumpbIndexNewModelsreadModelssessionAdminUserthisSessionmessQuerysessionClosesessionGainWriteAccess__ctypemesserrorbsCreatebsDoDestroyuAssFindassInsertmessErrorCountassHandleCreate_dbguAssDestroyhandleHandleCreate_dbgmessprintfstrnew_dbgshowModelJaqpickWord2Class ))5*M+e,-0 1  2 3 45/6;7U8w9:4;<=>9"/;?H@R WA\kpB~ CDEFG HIJ HB) . 3 8 =KN TIYaLlvJB M N 3',O<_|O!Nq vPQ 3RS TYU^VoUx }WU 3WX 3VW1 <3FWbqY ZG[ -I0R W1j ov2 3456565 6 7)  .  3  8  = KM  R  X \j ]z L 4 5 6 7 0 > ^         K.  3  9 \C LU ]Z _ `  a = W `   a =" WW bi  o ax = 1 c = > = = b W 4 d e. fH 7 `   a b  gU ia f jx k l m n n o p  N  N  M  q9U ZPcnbw|Qrf7s4b Bt; K3lqvBt 3t 3=fWrb7ms9 Z ZGuv w1 7Z?xHn` ez{{i|}|~ jh .[dbbbb b).PbY^pUxbbbb='b/1Mb\bej|bbbbbb Db]blbuzbbbbFl=0bbbbb%b.3Pb_bhmz 3bb6Q \Nl zN N=: 3 * 33;_l=qV 3bb bb(b6b?DRb^blb{bb B 3 3 3/=4VAQ W\Ze| Z  1 ?bH MV|   b bb!8. <`E JSq ` b=b D DNLhbq|  $(,048<@DHLPTX\`dhlptx|longtext.o/ 1133374773 530 202 100644 3948 ` ELF4( UuUuU u ujU u ujU u ujUuu ujUVSu u Ãt@jP PhVhV SuЃhVt Se[^UWVSu} WÃjS<$$ PhV) P PhVh,V Suǃh/Vt Se[^_UWVS hh3jhE$h>u+uA8tMuS uEu}u, u Ph[EC StSu  u t Se[^_UVSM ; QÃtxu8txuxu hh3SP5jS%P5hS5 Su˃uhh3j5Pƃt SЍe[^UWVS}Ehh3jjj þ OuWt<5EPuuEEhh3VFSUEP5uhS$؍e[^_%s ***LongTextEnd*** ?LongText?%s? ?txt?\n? longtext.c \***LongTextEnd*** no ***LongTextEnd*** found when parsing LongText %sGCC: (GNU) 3.4.3 (csl-sol210-3_4-branch+sol_rpath).symtab.strtab.shstrtab.rel.text.data.bss.rodata.str1.1.rodata.str1.4.comment4 ` %+02U?2<4Np4W`    &>$V*n05BJQYaiv !+5?JT_qylongtext.c_unameunamestatlstatfstatmknods1.0longTextGrep_nuname_xstat_lxstat_fxstat_xmknodlongTextDumpstackGetstackCursoraceOutPrintstackNextTextuStackDestroyjavaDumpLongTextnamefreejavaprotectlongTextParsestackHandleCreate_dbgstackTextOnlyaceInSpecialpushTextaceInCardmesserrorstackMarkstackStorearrayKill_VLongTextstackReCreate_dbgcatTextstackText_dbgpickMatchlongGrepuArrayCreate_dbg_VPaperlexReClassuArray_dbglexNextkeySetOrderarraySortarrayCompress 5Me   #@HPY _mv |     ! 8"F#aj o$%&'(? H%RW)\gv{* * +, .:/F0] e1z(2345quovadis.o/ 1133374773 530 202 100644 2444 ` ELF$4( UuUuU u ujU u ujU u ujUuu ujUVSEjEPh}t!E%e[^MatchTableGCC: (GNU) 3.4.3 (csl-sol210-3_4-branch+sol_rpath).symtab.strtab.shstrtab.rel.text.data.bss.rodata.str1.1.comment4h t%+02 ?4H   &>$V*n08?GOWfoy ,:K[j|quovadis.c_unameunamestatlstatfstatmknod_nuname_xstat_lxstat_fxstat_xmknodparseArrayInit_VKeySetparseFunckeySetParsedumpFunckeySetDumpFunc_VDNAdnaParsednaDump_VPeptidepeptideParsepeptideDump_VLongTextlongTextParselongTextDump_VTableResulttableResultParsetableResultDump_VBaseQualitybaseQualityParsebaseQualityDump_VBasePositionbasePositionParsebasePositionDumplexword2keymatchTableParsematchTableDumpmatchTableKillkillFunc   5Me !"#$% &'(). 3*K+R,Y.]-picksubs.o/ 1133374774 530 202 100644 16908 ` ELF%4( UuUuU u ujU u ujU u ujUuu ujUjVh E 5UEPUjEPEUSu8?u@ PÃ؋]US]؁v3;t!hh $%hh P5 ]UWVS]} Sƃvu9?8~ ~(hh SV%9tC9^ ۸e[^_VS\$ L$t;vc;uI=t@ցt69r v+tBDP [^UWVS Ehh jhhP$h jjj oEƁ P8_t 5 uP5hh WG50 EPjxe[^_UWVS }jEPWu 5EPW]=u# hh jjh hh S50= u# hh jjh hh S5 =tA5EPuPhPU艐t5Lt,hh 5WPtc 5W5 5EPWjjWuƃ BƃvE쉃L e[^_UWVS}t  jhhhhà u h$jhhSE؃t S}u hX=u)E h;h jjj  @ Ehu uE܃ŠBU<_BU?Class Is_a_subclass_ofChoose a classNon-class passed to pickIsCompositeCannot find Class definition file wspec/options.wrmCannot open database without Class definition file!Error in wspec/options.wrm at line %d : Isolated _V token, please specify a classError in wspec/options.wrm at line %d : no hyphen '-' at start of option %sError in wspec/options.wrm at line %d : unknown option %sError in wspec/options.wrm at line %d : Bad display type %spickSetClassDispType() - bad class name %sSyntax error in wspec/constraints.wrm, class %s : %s then use the option Read-Models from main menu.This database has no visible class. Most probably, you should study and edit the files wspec/options.wrm and wspec/models.wrm,  &&&&&&&&&&&&& ! \&&&&&& &&&& &o ! &&6GCC: (GNU) 3.4.3 (csl-sol210-3_4-branch+sol_rpath).symtab.strtab.shstrtab.rel.text.rel.data.bss.rodata.str1.1.rodata.str1.4.rel.rodata.comment4d 4` )p % d@x /!42!C2"V$R @0 ^`%4%g,(   / &>$V*n0:>I Xjzp >   -# P,:IT\2mr g t*4<GNWA)n j -8 PZeo(r -7GPcir{Hpicksubs.c_unameunamestatlstatfstatmknodpickStackclAclassMasksclassCompositepickGetClassNamesclassAppearanceclassOptionsdisplayOK.0doPickMatchpickDefaultPropertiespickCheckClassDefinitionspickRegisterClassMasks_nuname_xstat_lxstat_fxstat_xmknodpickVocListclassNamepickListstackText_dbgpickClass2WordsuperClasspickIsAclassModel2ClassnamepickWord2ClasspickIsComposite_VClassuMessSetErrorOriginuMessCrashuArray_dbgpickBelongsToCompositestackHandleCreate_dbgpushTextuArrayCreate_dbgstackMarklexNextpickMakeClasslexaddkey_VModelmessprintfstrcmplexAliaspickGetClassPropertiesdbPathStrictFilNamemessExitaceInCreateFromFileuMessFreeaceInSpecialaceInWordaceInStreamLinelexword2keyaceInNextaceInStepaceInPosaceInKeyaceInCarduAceInDestroypickSetClassOptionFREE_LOWERpickSetClassDisplayTypelexstrcmpFREE_UPPERpickMatchpickMatchCaseSensitiveuArrayDestroy_dbgpickRegisterConstraintsbsCreatebsGetDatacatTextbsDoDestroyqueryConstraintsInitstackClearuStackDestroypickPreInitREADING_MODELSsysClassInitclassInitsysClassOptionspickInituArrayReCreate_dbgiskeybsUpdatebsAddTagbsFindTagbsAddDatabsDoSavestr2tagbsFlattenpickVisibilityqueryParametrizedmessoutpickCheckConsistencyclassSortAll 5Me "#!&()1+@ E,LQ-e lq.* .(+0C_ 0 1 2( 3"$(.31= EJ.]46+6 2 .  2 - 49.H7T7c(l q8z6""" "#93"1+ 6:"&"0"R` e j o t<=  >?= 2 @+AgBpu= C5 .  .-D:ELAbFqBz=GFB=""","A"K"R"cDnAz"CB="A 6, "> A] 6v A " " "  3 "  1 " " "1 "E H[ I   2    5    .#  , 1 .B "L "R "X Ki "x " " " " " " 7 "  8 6 + " 6  5 CI  N ,W \ -x " C  "  # M  "  # M NN+N1NNNK] d.u"~"" QST- 60F K8U1e j8tUT&V3 #W #$"'=7XG+L4dY{[["""\+""] 5;^[[[/ 9>`K"W"^"h"r"~"""""\+""];^R[+(aB G6f"v+$6b"""a"""Kc""0cAcOd` o"y"#eeefST* 38.NT_ hm.~ gd 2h 2 . .8 AF.Z"t |QV+4  j+$C!S5dJ(R hVSd( V Q  # /49kYi^m     $ , 4 < D L T \ d l   $(,048<@DHLPTX\`dhlptx|alignment.o/ 1133374775 530 202 100644 7908 ` ELF4( UuUuU u ujU u ujU u ujUuu ujU=jhh jhh jh h jhh jhh jhh# jhh* jh h2 jh$h6 jh(h@UWVSlEEEE uƃ 5Pu juEZ jchHjjdhHPj EԋUXjghHSjj@MԉAjj!V uVẼ EPj!V= uVEȍEPjj!V EEuVEčEPjj!V  Vj{hHUԋBp rEEMEAEAE;EEЅtE;EPj5Vt&hhHEpuUBEP5 VE;t;$u uEu(E; uE hhHjjE+EDPǃ E;uPujj!Vt%V+n1:EPZ chmu~ $(s .;BKU_ju| u &2=HXhalignment.c_unameunamestatlstatfstatmknodisDone.0initialise_Alignment_Verbatim_Extract_DNA_Gap_Insert_Peptide_Seg_Translate_Protein_nuname_xstat_lxstat_fxstat_xmknodlexaddkeyalignGetbsCreatebsFindTagpepGetTranslationTablehandleHandleCreate_dbghalloc_dbguArrayCreate_dbgbsGetKeyTagsbsMarkbsGetKeybsGetDatabsPushObjuArray_dbgstrnew_dbgdnaGetpeptideGetcomplementBasenamemesserrore_codonpepDecodeArraydnaDecodeArrayuMessSetErrorOriginuMessCrashuArrayDestroy_dbgbsGotouMessFreebsDoDestroyalignDumpKeyaceOutPrintmessprintfaceOutBytealignDumpKeySetkeySetAlphaHeapmessout 5Me        $.3 8BG LV[ `f!"# $ % '&:'Q(c)z(*(*+ ,&8>*O ]-x~'./ & *> G,hw* ,**+ 4,L0t },112+' 9%345 67 , %-A I8a g8x (* *%2*G*k1z12+'9:  ,+  ; %v  *  *v  * *) +? '[ :j 9z * 9 ) 9 ' : : : 1/ 18 = 2M ;a :  1  =  > 1m  r >} ? 1  = ?    = :=AZ a,n< 8 Blogsubs.o/ 1133374775 530 202 100644 6700 ` ELF 4( UuUuU u ujU u ujU u ujUuu ujUWVS ]u tu=jSh' 1uP1u2Ph$;t Phh $hHhJShNà t.jhHPtt Stm}tghW6j5h 6NP$Pj Phd66;t 5e[^_ËD$UVS]u tu@hh' 1uYP1unPh55h Sn VhS$e[^UVSu] u!hh'$v#hh'Sh,t:j5h V ShVhWV V4$e[^UWVS }]DžDžhh'jƃu!hh'$t S Whh'jW$$ A VhhJPhN  VhjhhN  VhjhhN uShVjhhNPuvPhDžQhVjhhNPu#Ph$Dž& W<$}t-$Pu hPu P VhhJPhà t0PVhhJhNPu@PSVhhJhNPh\Džt)uPu Džt Ve[^_UVS]t;u!hQh'$hTh'j3$$ƃj3tjSVe[^Uuu 1}t $ Phu  NORMAL EXITABNORMAL EXITCRASHCLOSEDlogsubs.clogfile name is NULL awrmdatabase message text is NULLlogfile ACEOUT is NULL %s SESSION_END - %s rwdoldlogsrd%s-%swdatabase/oldlogs%s %s %d pointer to logfile ACEOUT is NULL Internal coding error, logfile cannot be opened because: %s%s.SESSION_START - User:%s, Program:%s, Level:%s, %s Internal coding error, logfile cannot be appended to because: %s%s.Internal coding error, logfile cannot be closed because logfile ACEOUT is NULL.Internal coding error, logfile cannot be closed because aceLogExitType is invalid: %dInternal coding error: start of new log file failed because startNewAceLogFile() was passed a NULL log ptr.failed to create directory database/oldlogs/ (%s)failed to chmod 755 directory database/oldlogs/ (%s)failed to rename previous log-file %s to %s (%s)Internal coding error: start of new log file failed because reopenAceLogFile() was passed a NULL logfile ptr.GCC: (GNU) 3.4.3 (csl-sol210-3_4-branch+sol_rpath).symtab.strtab.shstrtab.rel.text.rel.data.bss.rodata.str1.1.rodata.str1.4.comment4" D )`! %  /42C2T RR 4 [   &>#V)n/ <HY=hpwz%1FZnw  T#.@FWagoxelogsubs.c_unameunamestatlstatfstatmknodlogfile_hostlogfile_pidadd_timestamps_GlogPrintPrefix_nuname_xstat_lxstat_fxstat_xmknodaceLogExitStringsopenAceLogFileuMessSetErrorOriginuMessCrasheuidruidseteuidgetpidgethostnamedbPathStrictFilNameaceOutCreateToFileuMessFreeaceOutPrintaceGetLinkDateStringaceGetVersionStringmessGetErrorProgramgetLoginaceOutFlushsetTimeStampsAceLogFileappendAceLogFilecloseAceLogFileuAceOutDestroystartNewAceLogFilehandleHandleCreate_dbgmessdumpaceOutGetFilenamefilGetFilenameBasestrnew_dbgdbPathMakeFilNamemkdirmessSysErrorTextmesserrorchmodtimeNowtimeShowsprintfstrcpyrenamereopenAceLogFile 5Me     $ * / B H!c"x #$%&'#() .6 ? E N TYbhm| #(    #' -#9(A, . /( 012     / 6 ; @ T [ ` e   3456  3756&(.,?8G9S _:v;        <5    62P"  012+ 89 #    sigsubs.o/ 1133374776 530 202 100644 7004 ` ELF4( UuUuU u ujU u ujU u ujUuu ujUh} t "huh`áU h(uh3U h(ujUVS(uu]S jSjudjSjuPjSj u<jSju(jSj ujSjt PVh} t1jEPjt PVhe[^UWVS} h$EPh$y!hh$P}u e|eE%0EeEEEPhTh$y!hh$hj*jh$ =y h@yt YuEPhTh$y!hh$% υ]hj $7 h"u EVSPhu=t p", and reproduce the problem. // This will produce a "core" file in your current directory, // please keep it as the developers can use it for debugging. // // Fatal internal programming error in %s at line %d: // getSignalText() passed illegal signal number: %d (max sig = %d). // Program will now exit immediately. %s (%s)sigsubs.cUser initiated abortProgram killed...ABORT: Signal %d caught (max. possible)// If this fails, then this // This GCC: (GNU) 3.4.3 (csl-sol210-3_4-branch+sol_rpath).symtab.strtab.shstrtab.rel.text.data.bss.rodata.str1.4.rodata.str1.1.comment4 H %0+4024V?2 N4GWX  h &>#V)n/>J%X(b4EpxN'$y' #*4HS]dktz 2;CMRftYsigsubs.c_unameunamestatlstatfstatmknodsig_catching_GpanicBuffersignalHandlersignalSetgetSignalText_nuname_xstat_lxstat_fxstat_xmknodsignalCatchInitmallocsignalCatchStatussignalCatchOnsignalCatchOffsignalInitSigActionsigactionmessSysErrorTextmesserror__iobfilenoisattytcgetattruMessSetErrorOriginuMessCrashtcsetattrfwritefflush__filbuffputcmessExitmessExitRegistersessionGetServerCBmessprintffreewriteAccessChangeUnRegistersessionReleaseWriteAccessreadlockDeleteFilegetLoginaceGetLinkDateStringaceGetVersionStringmessdumpfprintfgetrlimitexitmessGetErrorProgram_sys_siglistp_sys_siglistnsigemptysetsignalSetNoCatchsigaddset 5Me    ;H\p  :!?"G#^!c"k$% &!"'% &! "()!.)7!=!H!M*Y!b!!"'% &!!+!),-#,5.[-`e,w.-/,0123456! &70 5!:8K9\a f!k8w:; !8!(!(! ( ! ((:><D=W\ a!f8p:>@prefsubs.o/ 1133374776 530 202 100644 11960 ` ELF$4( UuUuU u ujU u ujU u ujUuu ujUWShjP=t/hRh5 h t5 h PSfD/I .aceD dbrcD hhSt?jhhSÃt$5P$e[_UWVSh tZ h PSI /.acD edbrfD c hhSƃVj.jhVjCjh0 ƒx Bx u"x(uRPh Vlx up(Ph)VRx up(Ph4V8x u@($Ph?V x up(PhJVC9Z T Ve[^_U=u1 jhhhUhh=u 5áUWVSXhhjj U ;B tRhtMK| uu F(D (MKD w u F(D (}MK| u u F(D (aUS| u<|(t t(USD(MKu F(D (u hZUSD$EEE9C }u-U B$hhs Su e[^_UWVS\u} E`9_W CD*Bu<_u~D*uQhL <-t< t C<-t< u<-|tt|Tu8EEEEEEPW|ft|Fu8EEEEEEPW_Z|It|iug\EPhSt1EEEEEPWEPhx|Ct |c\EPhSt1EEEEEPWjEPStI}cvC}w:EEdEEEEEPW+&EPh |Rt|rug\EPhSt1EEEEEPWEPh|St|suv\C; t; u; uH; tCh"hjSEEEEEEPW,*EPhEPh Ve[^_UWVS }Et(?t#} t=txuxuChHht?t} t "Ph>ƒx BSWt}{ uE C0 s(S0C(YC wE C0 s(S0C(7{ uE C0 s([({ uE C0 s(S0C(EF9r XEe[^_UWVS }Et(?t#} t=txuxuCh}ht?t} t "Ph>ƒx ~VBSWt/{ uE C4{ uE C4 { uE C4EF9r Ee[^_UWVS }Et(?t#} t=txuxuChht?t} t "Ph>ƒx ~iBSWtB{ uE C8-C wE C8{ uE C8 { uE C8EF9r Ee[^_UWVS ]t";t=txuxu aF(\ƒx ~EB2VSt~ tȃVhYG9z e[^_UWVS ]t";t=txuxu [F(Vƒx ~BB2VSt~ tȃVhpG9z e[^_UWVS ]t";t=txuxu fF(aƒx ~JB2VSt#F vÃVhG9z e[^_UWVS ]t";t=txuxu aF(\ƒx ~EB2VSt~ tȃVhG9z e[^_UWVS }Et"?t=txuxuEƒx ~FBSWt{ u[(]ShF9r Ee[^_prefsubs.cHOMErwTRUEFALSE_%s -%s _%s -I %d _%s -C %d _%s -R %f _%s -S %s prefList_G != NULLFailed assertion: (%s)OLD_STYLE_MAIN_WINDOWSPLASH_SCREENACTION_MENU_IN_TREE_DISPLAYNO_MESSAGE_WHEN_DISPLAY_BLOCKTAG_COLOUR_IN_TREE_DISPLAYBLIXEM_SCOPEBLIXEM_HOMOL_MAXBLIXEM_SCRIPTBLIXEM_PFETCHBLIXEM_NETIDpubseqBLIXEM_PORT_NUMBERUSE_MSG_LISTMAX_MSG_LIST_LENGTHDNA_HIGHLIGHT_IN_FMAP_DISPLAYacedbrcwspec%dERROR reading colour after %s%fERROR reading float after %sERROR reading string after %sError reading value for %s.null preference name as argInternal Coding Error: %s.%s not of type boolean%s not of type float%s not of type integer%s not of type colour%s not of type stringThis file contains the preferences for ACEDB. Do not edit by hand. Use the preference editor from the main menu. ERROR: Prefile reading in the preference %s but does not have the same type definition as that in the master copy. This will be ignored.ERROR: Prefile reading in the preference %s with invalid type, ignoring.Error reading name after _ in %s .acdbrc ERROR reading integer after %sCallback function pointer is NULLprefInit() has not been calledGCC: (GNU) 3.4.3 (csl-sol210-3_4-branch+sol_rpath).symtab.strtab.shstrtab.rel.text.data.bss.rodata.rodata.str1.1.rodata.str1.4.comment4 h'P %+082G2V4_!  %T &>$V*n0;M^ mn' v~@ {$,5D\EVju}HK",26>rIprefsubs.c_unameunamestatlstatfstatmknodprefList_Guser_prefs_read_GmakePrefDefaultscopySystemPrefsprefAdd_nuname_xstat_lxstat_fxstat_xmknodprefInitmemsetuArrayDestroy_dbggetenvstrcatfilCheckNameaceInCreateFromFileprefReaduAceInDestroyprefSavestrcpyfilopenfwritefprintffilcloseprefReadDBPrefsmessAbortOnCrashuMessSetErrorOriginuMessCrashprefGetuArrayCreate_dbguArray_dbgstrnew_dbgdbPathFilNameuMessFreestrcmpmessout__ctypesscanflexword2keyaceInCardprefSetDefFuncstrstrprefSetEditFuncprefSetFuncprefValueprefFloatprefIntprefColourprefString 5Me $mrx !#16<$SX%bg%t&&&&&#5'LY)fk*sx}+- .&cl.."+.=}..09.K.. %,1/dm..//8.J..; D .V   .     0      ! 1_ 2  3 1? D 3  . 4  3  54 9 3c i 5 6 37=53/ 3#3/7lt*+9{* +79t*+,9|9 3IQs93+9FK3\932:Zv93status.o/ 1133374777 530 202 100644 10952 ` ELF4( UuUuU u ujU u ujU u ujUuu ujUhuUWVS ;5`}7tuuU  ߉C;`}tΉe[^_UWVS]u hhXj4u!hhX$Hu DžHaDžuaDE{EPEPEPEPEPEPEPEPEPEPEPEPEPEPEPE< EPEPEPEAceDB status at %sCodeProgramVersionBuildDatabaseTitleName%d_%dReleaseDirectory%dSessionUserLast SaveYesNoWrite AccessGlobal AddressDisk blocksUsedAvailableThis SessionallocatedfreedLexiques%luclassesallocated (kb)keyskeys in lex2names (kb)hashing keysHashesniinicnwcnwfnwgIndexingNot AvailableversiontableskbCache 1SizeCurrent BlocksusedmodifiedlockedfreeCurrent Objectsservedsavedread from disksaved to diskCache 2slotsCurrent content (objs)knownObject Usageread from cache1saved to cache1BS memory cellsBT memory cellsmadecurrentused (kb)ArrayCache2Cache1MessallocblocksMessalloc - blocks- %s%s%s: %s,%s -%s: %s%sInternal Logic Error: ACEOUT ptr to tStatus() was NULL************************************************Please read models and avoid using code prior to 4_7)Arrays (Including the lexiques)Cache statistics: each layer serves the known objects or asks the lower layerOverall Memory Usage (caches 1 & 2 + arrays + various)************************************************ GCC: (GNU) 3.4.3 (csl-sol210-3_4-branch+sol_rpath).symtab.strtab.shstrtab.rel.text.rel.data.bss.rodata.str1.1.rodata.str1.4.comment4D )d % h*` /42&C2 ~R4[   r &>"V(n.`=`J3DWD_whlsz\"6@IR[go )7;?CGKT^fstatus.c_unameunamestatlstatfstatmknodstatus_types_Gstatus_num_GdoSimpleLinedoTitledoSingleLinedoLinemyText_nuname_xstat_lxstat_fxstat_xmknodtStatustStatusSelecttStatusSetOptionstrcmphandleHandleCreate_dbguMessSetErrorOriginuMessCrashsessionDbNamesessionDBTitlesessionLastSaveTimediskavaillexavailBSstatusBTstatusarrayStatusaStatusmessAllocStatusblockavailbIndexStatusblockStatuscacheStatustimeNowtimeShowmessprintfmessGetErrorProgramaceGetVersionStringaceGetLinkDatethisSessiondbPathMakeFilNamegetLoginisWriteAccessNIINICNWCNWFNWGblockMaxuMessFreehprintfaceOutPrint 5Me 6 ;BG O!c h"s x#$%&'($)/*J+],-./0 1  +24 ?3H S4\    55 1    6 5  1 )72 F Q8Y b h w5| 1   1  1    !1* = B1K p  1  1  1  1  1 5 :1C h y9~ 1 : 1 ; 1 < 1 = 1" G af  1  1  1  +>( -16 C H ^ c1l  1  1  1     1  $  ) 12  H  M 1V  o  t 1}    1   1     %  * 13  I  N 1W  p  u 1~     1   1   1     1&  6  ;  N  S 1\  r  w 1     1   1     1  3  8 1A  a  f 1o   1      1     1  ,  1  G  L 1U  n  s 1|   1   1     1  1$ = B1K a f1o    1  1    $1- P U1^ y ~1  ?? @'?> E@k? @?2 > M T@} @?0 8A    $ , 4 < D L T \ bindex.o/ 1133374777 530 202 100644 17780 ` ELF'4( UuUuU u ujU u ujU u ujUuu ujUWVS ]u tgtc1v^uUVStrt470 SÃtVPlj$e[^_UWVS ]u tUtQ}tK1vFu=VSt, SÃtuVPlj$e[^_UWVS ]u }1EVS SÃtnEPVStMVSƃ uj!St VS EPj"Su Se[^_ËD$u Ãu= uUVS=tQP Ex ~ÉAxt@p B9S  E je[^UWVSEu PǃVPJ= t1w 2=  B9X Pt{u{u  9p  Pt9C }Sth9P ~YP92Czt2h<hPrمuȍe[^_UVS]u VS= t1w = B9X P tyuyu 9p vv Pt9A VQ tA9H ~2B90uxt pƒЍe[^UWVS<]} t uE ځU Bt+hh$Ph tB~u9~t3v 5,,PVSu PSj 5,,=X t0KMM̋EE9~~LhhFP5,V~ujW$FhhỦURvMȉMu>F$hhuvEċM Mĉ~hhEEPvUUxF$hhuvUU!8>/} 6u ~ujW$FhhMMQvUU؋u>F$hhuvEċEع Eĉt~tnhhUURvMMЋt:F$hhuvMк !K\e[^_UWVS ] Bu]uT SǃOt@]%] à SƃPSt VOuƍe[^_UVS h( Buu S,FKu 555hT55V5h e[^UWVS U Bt!hh$ =(tD u uPu PEPPh }t.jEPuuh$PEE h*hu 5 Eu-h,hu 5 BUh.hu5 Eu-h0hu5 BUh4hu58uJ h7hjjEPà h7hu5$h=huW0t-h?hV5tU 9u HhEhuW0u%hGhuWR fhIhV5Ã;Et=hMhuWR fhNhV5à CSЃC;tЃCEUSPRC {thWhsChXhuWf0KECU9St!h^h$h_huWf0=(tHuuPu u PEP PVh< e[^_U jEPh/E% jhh3UWVS }]u"{(uVsu W{)u{tVCpu W{{1{tVsu WsE5EPV$}tu5W{tVsu W'=(t< VPs PE PPht{tjVsu e[^_UVSE uÃEEEEPEP}tY}uSE BuAu8t. Pƃt@jpuS4$ SEP5Ce[^UWVS  BuCu: t0~u'~t!~ ~~WjjShG9~ Kue[^_WVSD$T$tu_H Z 0:>t+It%Kt9u*>t ItKux>u x?t [^_UWVS = u j h9p hhjPà NtCNup hhjPÃ$hjjhǃ NC t-{thhsC{ thhs C CC$ sC E3sC {tqPuua}t. 3 PCPPhhhsWC$}t|hhub{ thhs C 3sC hhsWC$ NA_ Kt!W<t SFKu߅th"hW 55V5h55V5h e[^_UWVS=$t = u :5EPhF hP5 u@ E$?hjjPE M}hBhu5E5EP uhRPEp $GhjjVǃ Nt4hIhVWhIhVu Nũh[WuthKhWhLhuuUM}5EPh] hPuu}thPhu@ E hUhjj Pǃ M}hXhu5hYhuWËFCFEE uY5EP uhgP}t| uui uFR5EP uhgP~th[uuECFM}5EPhq h|WuthphW$e[^_UWVSEEEE=p5EPhFhPjuEÃ5EPh]hPjuE5EPhqh|j uEbE Es Nt;~NuUr hhjjV NhhVuEh[jPE؃x hhjjWE܃ Ot6hhWuhhWuf Ouʃ}thhuhhV5M܉EN}thhuEp hhjjV NhhV5EhhVuËM@ARqUB CEt h[jPE܃tLMAE@Nr}thhu A}thhu}thhu}thhu= t%hh5  =p NtvhhV58tRhhhhV50hhV5Nu=t%hh5=p NhhV5xtThhhhV5phhV5@Uz t"hhr MA NX=t%hh5e[^_US=ƒx щQ| t6hhQt PD Q|t6hhQtPDC9Z ^=t%hh5= t%hh5  =ƒx ~whhSR8tRhhhhS50hhS5C9Z =t%hh5]UVS]u Ut ht -=~=   ht95~ h0u h$% h0hjjh h1hjP$2hjjhh3hjjh  q}e[^UVS=tp t NtS{thKhsC{ thLhs C Nu=t%hNh5=tp t Nt+;thSh3NuՃ=t%hTh5= t%hUh5  e[^ @ @ @ @bindex.cNon B class i bIndexCreate_bix_%d_%dTagIndexIndexing ...__ttArrayk__cta_%di__ctArray__bixa_%d__bixArraykikACEDB_NO_INDEXACEDB_INDEXbIndexObject called on non B class %sIndexing (this may take several minutes)Indexed %d tags in %d objects totalling %d nodes Indexed %d tags in %d classes containing %d objects totalling %d nodesCreate an Index bix for class %s tag %s targetTag %s filter %d inconsistency in bIndexCreate, sorryCreated bix %d for class %s tag %s (tt=%d) targetTag %s (targetTt=%d) bIndexRegisterSecTag class %s, tag %s masterTag %s In model ?%s, tag %s has moved, reindexing Reindexed %d tags in %d classes containing %d objects totalling %d nodes Do you want to index this database, this may be slow, but will accelerate future accessSorry, you cannot gain write access, I cannot index this databaseGCC: (GNU) 3.4.3 (csl-sol210-3_4-branch+sol_rpath).symtab.strtab.shstrtab.rel.text.data.bss.rodata.str1.1.rodata.str1.4.comment4;# <48 %# +$002$?2$Nj'4'W)` & 0) &>"V(n.7=DLS [dr $(, 9  < DP+(nA}PcKqyws-p)4CLWMfr,6HQZbks{"< 5g!xbindex.c_unameunamestatlstatfstatmknodbitField_VTag_IndexctArraylastTtttArraybixArraynIndexedNodesnIndexedObjsindicesMayBeReadFromDiskindicesAreUptodateindicesDirtydebugbb.0bIndexClassbIndexDatabasebIndexCreatebIndexInitStaticsbIndexRegisterSecondaryTagbIndexRegisterTagsbIndexRegisterFiltersbIdenticalPathbIndexInitFromDiskbIndexDestroy_nuname_xstat_lxstat_fxstat_xmknodbIndexTagbIndexFindbsCreatebsFindTagbsDoDestroybIndexGetKeybsGetKeybIndexGetTag2KeybsGetKeyTagsbsMarkbsGotobIndexVersionbIndexStatuslexAliasOfbsIsTagInClasspickListuArray_dbgbIndexTagCountbitSetCountbIndexObjectuMessSetErrorOriginclassNameuMessCrashbitSetReCreatequeryIsAlexSetIsAlexMaxbitSetCreatemessStatusmessoutmessdumpnameprintfmessprintflexaddkeyuArrayCreate_dbgbsGetPathuArrayDestroy_dbgbsAddKeybsUpdatepickIsAbsDoSave_VClasslexNextbIndexNewModelsbIndexInitbIndexSave_VCalcularrayStorelexword2keyiskeyarrayKilluArrayGetreadModelsgetenvthisSessionmessQuerysessionGainWriteAccessbIndexShutDown &&5'M(e)*,-./H,X-n1x/,-34+1C5R3b/~6&859Kh::1;gu;9::"0bl=:*::??G@PUAi:BCDB -2;D[EcFs;;;/=H;P.EF; ; $ 6 H ;[ m {  ;   : : E - >$ /B G GM W t :} :      H     I : :  ?$ ) A2 F JU Jh @q v K  L M   ;   ;     ;, 5 : ;@ G Y b g ;}  N   ;   ;   ;  ;+ 4 ;: P W \ ;z  ;    ; O P;FK?RWAdm;yJJ@KMMJMQJJ@!&KkRS:::-/T UV>:G:P:+X@EGJW_;;N P*2PVjE}OJ@I; P-5PLOYb;uPH!&I@I_ZhmMu{[N;ZLM!N6=;IR;hq[P;ZM[P%NAJO;[d;ZL\]^ZLM[EZNSM[d[x~PZ\_!Z*/\BL_cZlq\_N;2:_XbNx;;P; P",N1HOT;aj;O_PP/7PMUP^ntyP;;P;-38PAKWnuz;;P;P"(-P6TePP )/4P=GW]bPku;;P;   ! & P/ P ^ `p u a  b   a b  c d!!H!/!=!NB!O!W!;i!w!N|!!!N!!!!! ""P."6"PO"_"e"j"Ps""""""P""""P"#####P,#acelib.o/ 1133374778 530 202 100644 25312 ` ELF64( UuUuU u ujU u ujU u ujUuu ujUWS]=t €8u=utI jgh5 Re[_UWS]=t 5t;tI'vjnhjh*=u jqhjSe[_USjÉ$$]Ujh jEjhh Uuh h hhj$hPjj hhjPU=u! h zR=u hP2}t%u h%‰U=u! h U=u! h R jt' j}u j hKUWVS u=t2X Kt$ St V!ǃKu܃ V=t 5tt h@e[^_UVSut>u hplhh5 hhPj,ã C hhsVCsCsCsC C@ C hhs 5C e[^UU~=t 9P  hrRh-hR5t zt h3B U=t=xu@ ?=t!h@h$$ hUS=u! h =X 0tX hK]US=u! h !=X ut S hP]USE=uR h ]t'{u sC SEPp u@hyhp 55  ]UEu =u! h hhPUhh5 u u UE=u! h Pt PUWVSu] V}ǃy$Vh=Pt$VhQPu" h$ ju h lbhhjP5 SPEhhj5 à 8t8%t C;t;%uC<%ue;ttC;t uCu t>:t Ct;:u;:u{u C VxEPSux Vy!Vh@P>GEPSu!ShdP E0UE e[^UVSuEhhjVÃ=u$ h PEPEPt uyt SY} tPEPuE;PEPutEVhPe[^UWVS EEu =u$ h  hhPjj Ǿ Ex ~Su hhVu0Ãt$hhuEWFE9p ;utthhWe[^_US]t7;u/ sC sSp ]UShhujÃhPE C@ CEC Sp C؋]US ]Spt PSpjS]US]=u$ h 1$ S Bt:S PSPhPvu:S PSPhP4 StTSpu[S PSPhP$jSSpЋ]UWVS ]=u$ h v6t{u {t{t h9C Eh_hjSE;}}_hbhWS0VpthdhWu Vt+G;}|}thhhuWOt.hmhWu0t V Ou҃}thrhue[^_U=u! h  hU=u! h  Ep UWVS u=u! h u| hhjjj ǻ ~ ~*hhSWN R C9^ փ WÃthhW؍e[^_US]=u$ h ?2 S Bt:S PSPh$PLu:S PSPhPP  StdSpu7S PSPhP7PSp SSp]UVSu=u! h Dm^ Kt_hhSV0u4C9^ ~'hhSV0C9^ ٸ Kue[^U=u! h  hUS]=u! h U\{tQ s t: sCs s CCЋ]UWVS }=u! h w NtqhhVW0uFF9w ~9hhVWsCs F9w Ǹ Nue[^_UWVS }EE Eu E=u$ h Wpt W<$þ' WÃWptuSWEp0W PWPhPEe[^_UWVS =u$ h EX hhjjSǃ Ku hhSu0ƃukCE9X ~AhhSW0hhSW CE9X thhW"hhSW0KFe[^_US]Stu SƒЋ]U=u! h  hxUS]=u! h Nb{u h'E sC{v s C s ]UVSu=u( h @9^ Kt+hBhSV0tKuոe[^U=u! h > hUS]t;u S;P t {w hv sC} t s CC< s Ccs p Ps p]UWVS u} =u( h )D=^ Kt/WhjhSV0tKuѸe[^_UWVS }] u =u! h m Wƃt&SP} à hhV5W PWPh*P!e[^_UVSuu5 =u! h :ujÃVP: ƃthhSe[^UVSuu5 =u! h l;u uÃVP ƃthhSe[^UVSuu5 =u! h @h u uÃVP9 ƃthhSe[^UVSuu5 =u! h k@h u uÃVP ƃthhSe[^US=u! h ;h u uX thhP]U=u! h u uUVSuu5 =u! h 4@h u uÃVPƃthhSe[^øøUhEUhEUhEuUhEQUWVS u] u =u! h M5EPVuVhP}tSuǃe[^_ËL$t9u Q;P tËA UhEiUMt9u Q;P tE u PqjUMt9u Q;P tu qUMt9u Q;P tu qUVSut>u V;P t<v5$$u vÃ5$v؃e[^Uj"uUj"uUj!uUMt9u Q;P tu j qUMt9u Q;P tu j qUMt9u Q;P tu jj qUMt9u Q;P tu jj qUMt9u Q;P tu jj qUMt9u Q;P tu jj qUS]Mtyuyu h0A9A t;u S;P tuQu s]UMt9u Q;P t0yw h qUVS]u t;u S;P t9{w h`VsjVj s e[^UMt9u Q;P t5yw hu j!qUMt9u Q;P t5yw hE Pjj!qUMt9u Q;P t5yw h7E Pjj!qUMt9u Q;P t5yw hE Pjj!qUMt9u Q;P t5yw hwE Pjj!qUS]t;u S;P t7{w h sC]UWVS }tN_ hhu wCPƃ h hSP^ _ S76e[^_Uu uokacelib.cNo Active Aced contextaceGetContext, bad magic// Bad classname %s// Class %s is protectedName %s allready exists Failed to read models, sorrySystemFIND %s%s:%sTag %s unknown%s unknownaceReadLockKeySet, bad keySetunimplemented, sorryyunimplemented, sorryUnlocked instanceNo dna associated to %s:%ssorry, not yet supportedNo active context, please call: aceOpenContext("clientSignature") before any other operation, merci.// NB: changes made since the last explicit save have NOT been saved You cannot gain write access after it has been permantly forbidden.Sorry, you cannot gain write access.Sorry, you do not have write accessaceQuit: commit failed on at least one contextaceOpenContext called with null clientSignatureaceSetContext: unknown context, sorryaceSetContext: obsolete context, sorryaceGetContext: no context, sorryacePushContext: accidental failure, please report it, sorryacePopContext: you can only pop out of a pushed context, sorry// Usage New Class Format: Construct a new name according to C-language printf(format,n) // Example: New Oligo xxx.\%%d // Sorry, you do not have write access// Only allowed format should contain zero or once %%[number]daceAllowBlocking: usupported operation, sorryUpdate command unimplemented, sorryaceClassExtent: unrecognized classname %saceComposeName: bad class name %saceComposeName: bad instance name %sfullNameSplit: bad class name %sfullNameSplit: bad instance name %saceReadLockKey called on non B key %s:%saceReadLockKey called on non protected key %s:%saceReadLockKey: key %s:%s is allready write-locked, sorryaceWriteLockKey called on non B key %s:%saceWriteLockKey called on non protected key %s:%saceWriteLockKey: key %s:%s is allready locked, sorryCannot open the object %s, sorryYou cannot refresh a not-open instanceaceOpenModel(%s): unknown model, sorryarrayCreate units before calling aceGetArrayGCC: (GNU) 3.4.3 (csl-sol210-3_4-branch+sol_rpath).symtab.strtab.shstrtab.rel.text.data.bss.rodata.str1.1.rodata.str1.4.comment4- N` %-+-(02-^?2/]Nu545W7 " D  &>"V(n.7@L Ygw% X Bi-]1 J:f+D;,kM$T\cks{b(+<GXUjK&L  .AQa`kwc:ss|JTV&0&8AOW^h y dt     @@",7FmMY`jvoSw GC/TF{V^q{/Gv &46G}y-G=O d"!nu!}}W"~"X##qL$C$%%%$B%$*f%$5%$@%MUK&'fr&$v&H~&A'Dc'k''' (> K(>  (=% / (=; )=J @)=U })ua l )[v  M*k  *`  +`  x+` +` 8,` ,f  acelib.c_unameunamestatlstatfstatmknodACEMAGICINSMAGICaceMayWriteactiveHandleactiveContextaceContextArraysessionHandleactiveErrorBufaceSetErrorMessagedefaultAceCrashRoutinelocalStack.0aceClassNumberpushKeySetOnHandleaceCheckObjNamefullNameSplitinstanceFinalizeinstanceCreateaceDropReadLockpushArrayOnHandlemark.1_nuname_xstat_lxstat_fxstat_xmknodaceErrnoaceErrorMessagestrnew_dbguMessFreeaceStatusaceOutCreateToStdouttStatusuAceOutDestroyaceQuit__iobfwriteaceInitsessionInitfreesetfilehandleHandleCreate_dbguArrayCreate_dbguArray_dbgmesscrashroutineaceGetWriteAccesssessionGainWriteAccesswriteAccessPossibleaceForbidWriteAccesssessionReleaseWriteAccesssessionForbidWriteAccessaceCommitisWriteAccesssessionCloseaceSetContextaceCloseContextfiltmpcleanupreadlockDeleteFilesessionShutDownaceOpenContexthalloc_dbglisteCreateaceGetContextuMessSetErrorOriginuMessCrashacePushContextacePopContextbsDoSaveuAceFreelisteNextaceHandleCreateuAceArrayCreateaceMakeKeyFromFormatmessprintfpickListstackReCreate_dbgpushTextstackText_dbg__ctypelexMaxlexaddkeyaceAllowBlockingaceReadModelsreadModelsaceAddUpdateaceClassespickClass2WordpickWord2ClassaceClassSizeaceClassExtentqueryParametrizeduArrayDestroy_dbgaceNamenameaceClassNameclassNamelexcleanupaceComposeNameaceTaglexword2keyaceKeyaceKeySetbsDoDestroylisteRemoveblockSetFinaliselisteAddlisteFindlexUnsetStatusaceReadLockKeylexAliasOflexGetStatuslexSetStatusaceReadLockKeySetarrayCopy_dbgaceReadLockHandleaceReadLockInstanceaceReadLockInstanceSetaceWriteLockKeylexlockaceWriteLockKeySetlexunlockaceWriteLockHandleaceWriteLockInstancebsUpdateaceWriteLockInstanceSetbsCreateaceOpenKeyaceOpenKeySetaceUpdateKeyaceRefreshHandleaceRefreshInstanceaceRefreshInstanceSetaceCommitHandleaceCommitInstanceaceCommitInstanceSetaceDnaGetdnaGetaceGrepqueryGrepaceGrepFromaceQueryKeyqueryKeyParametrizedaceQueryaceFilterKeyaceKeyHasTagbIndexFindaceFilterKeySetaceAqlaceMakeInstanceTableaceTableCellaceTableByNameacefprintfacesprintfaceOpenModel_VModelaceKeyOfInstanceaceTestInstanceaceMarkbsHandleMarkaceGotoMarkbsGotoaceGotoTagbsFindTagaceHasTagbsMarkaceNextChildaceNextBrotheraceGotoChildaceGetTagbsGetKeyTagsaceGetKeybsGetKeyaceGetIntegerbsGetDataaceGetFloataceGetDateTypeaceGetTextaceGetArraybsGetArrayaceRemovebsRemoveaceAddTagbsAddTagaceAddKeybsAddKeyaceAddIntegerbsAddDataaceAddFloataceAddTextaceAddDateacePrunebsPrunememcpy ""5#M$e%&)*:AF)KV'_'jr)w,-./0130456"/77C8G]hs':;' =>.9D'\9a@rA9BCADE*(1FHv5H)II I+497[cp7 KL'CNY'lyG'CB 0;F'oOPQ7P!,'GM5bhs6'*U V ! UC H Ug 9v    W  X   Y Z Z@ h p u Y [ U \  U  # . 'F ?K __ {     '  6 V  b% )1 ; 7e cs    ' [ V, 2 = H 'n t y U f  g  U   'i%0;'Tkil'U!&UCPUU^)'\oUUU%)0;F'*\oU%0'NX6~7p7g r (sGQH[atgruvsw'-yAVMiZkchUikUzvik U/{8@ualw'}7v!75xU]gw7g'$/'Kxbmx'67|g%0'WykVwikUikUz vi(k16US[sgpxu'77 7BM'c'r&1'U\7f}7r'.6vFNcnvvikU'!+6MV7`7P7g7&>IT'j'r"-8'cj7t' ) OD ^ p x v  s   '  7!7!=!H!S!'j!!!g!h!j!!U!!!"'"A"G"ge"k"v""'"""g""""'# #B#H#gf#l#w##'##f##g###'$$2$8$gT$_$j$'$$$$$'$$f$%g%%0%'I%T%'m%x%'%%'%%%%'%&o&&U8&U&_&y&&'&&&&&&'.'8'R'q'{'''''''''((&(B(Z(d(((((((())7)O)Y)t)))))* *%*?*^*h******* +'+1+K+j+++++++ ,*,G,Q,k,,,,,,-.-6=-D-7X-table.o/ 1133374779 530 202 100644 45704 ` ELFi4( UuUuU u ujU u ujU u ujUuu ujUWVS } tE 8ujPh$} t]U 20Dw$jZh FPM 1Ph0F} I9rjfhuj0EhKP} johjGU IMEHjrhpu UB jshr]SMA jthqS}G juhwSGjvhwSG jwhwSG jxhwSG$ jyhwhG(@u w(}?E@;uEP2t2UB MA}_ w(hw($hwjuWhhwjuWhhwjuW wuW$F;u$ uHu!hh$XEe[^_UEt PUWVS }u hw E hhG HPUB$0W J!hhG HPUB0  ~$UBXWF9w ܋Ee[^_UWVS EUz~R<kuE@M9A} hhu jj ǃutqhhUBM@ HPWUB‹Mx ~._MPFMQM9p ҃hW<$e[^_UWVS}WEu!hh$u wW$Ãx(t p(C(hhsw(C(^C<t%hhC4ChhsG4SC<t%hhC4ChhsG4SC<t%hhC4ChhsG4SC$<t%hhC$4C$hhsG$4S$S G SGF9w؍e[^_UVSu VCu!h h$~~N@ 9~B9V؍e[^US]SlCu!hh$ C]UVS]u S(Cu!h%h$Px"9s~h(hC 4s(e[^UWVS}WBu!h4h$} xE 9G*h6h GHPu h}u!h:h$h<hG U 4w(Ƌ_ w(U uw(e[^_U ju uwBU ju u_BU ju uGBUWVS}u WAu!h[h$}tqE8tih_hPG$U4!h_hVGU4Ãw(uw(PhchPG$U4!hchVGU4 hehPG$U4!e[^_UWVS]} uSL@u!hoh$LC9x C0a$CP<CP<tjcCP<tOHCP<t1*CPE@tȍe[^_UWVSu} V7?u!hh$Fx ~|WSVt0hhPF$4ك .hhPF$4ڃ!CF9X e[^_UWVSu} Ve>u!hh$~ hhjWF4VhhjWF4VhhjWF 4V WF$4V$C9^{e[^_UVS]u S=u!hh${~I<0tK:t <0tYB9Sܺ{~<0tK:tB9Sshhjs(Pe[^UWVSEEE EEƒx ЋUPE܉օxuN@$ EAUt/EAUx}D@$EBMt}DN=G]XMH; G0b$d AUPEAUPEEPEP}@MH@E< t N}ib@MH @E+ }/(@MH@E ٺEtE@Ѓ}h'h AUP4q(h(h AUP4q(PSt9}XT@MH @E+ t })%EE9B E9EDe[^_UWVSHu9u!hRh$} u!hTh$H} эy9 h[hjS5 EPhU DrP}~ MA;E} E }Uz2hhSu>}My1 hhSu>UBt-hhEPuM EE9E-}thhu}thhu}thhu}thhuEUM9Qg}t ue[^_UWVS(u4u!hh$t uEEx} EEU9U9MA<0sufhhAUP4q(hhUBUP4Mq(SPu1!]C]XMH; uF9d EE9E9UUMAMH@E ]CMH@E C MH@E EX$EBMt-hhEP4M 0hhEPUB$4M!F9E]9]79}UBMAP F9|e[^_UVS]u tuIvsu/{~K<0t F<0u B9SЍe[^UVSu ]SVtSuVuƒЍe[^UWVS EE xU B8b$U BupUBMH3; rEfU B]XUBUPE@*EU BupUBMH3; EU BupUBMH3; EU BupUBMH3; tzEqhnhUBUP4Ep(hnhU BUP4E p(SPtEGU 9z4}e[^_UVSu ]u+5VPV$ÃSVtSVuЍe[^UWVS} uƻxG0D[$hhPUB$4!hhVUB4WMJ  hhPUB$4!hhVUB4WMJ  hhPUB$4!hhVUB4WMJ  +hhPUB$4!hhVUB4WMJ  hhPUB$4!hhVUB4WMJ  hhhGUP4w(PSVu1hhPUB$4 C9_e[^_UWVS }u!hh$u uK uEu EE8u-5UrEEEPMvExЍXMxH9t!hh$EpU2;]}M1uSC;]|;u}N;}}!u VuStC;]|߅uE0u VF;u|Ѝe[^_UWVS }u!h&h$4u u% uEu EE8u/5UrEEM)QUrMyЍXMxH9t!h7h$hEpU2t];u}N;}}!u SuVtC;]|߅uM1uVF;u|Ѝe[^_UWVS }u!hhh$u u- uEu EE8u75UrEEUUPMrExЍXMxH9t!hyh$EpU2t];u}N;}}!u SuVtC;]|߅tM1uVF;u|Ѝe[^_UWVSu ]}WVuWSVV PjuÃWVu؍e[^_UWVSE P UHM@EExUB<aSREuEu8tu"8uEE8su@EU:uEEM PUhhSuCM9Y;e[^_UWVSLEXEvEiEfEdEtfEkfEKEgEExtXt ytYuh'u}YVu5Cu jEPuE@>~EPh-uUB} 9x ~2B$BuUB<00}ÃC6wh$h0u{h4uchDuKjEPu2hJuUB0a$}GU PEÃA8$< u Ph-uUB0gt kt/jEPu jEPu] uuUEӈBjRuUEӈBjRu uE QRu u$Pu PhOu E9p|$UӉUhNhVp};8t8 u$Pu PhOu' u$ PhWuhThVEpUӉ UӉUhWhV}wU;u, u$ Ph-u h\hV}wUӉ u$Pu Ph\uH u$ Phbu u$PUиn}t R Phsu u$$ u$PUиn}t R Ph4u x u$PUиn}t R Phu1 u$ Ph-u UBU P4}G 4EÃC6$ uUB4hu }9w}G4huuhWuf jEPu UQRu/ uhbu uUB4hu uu}G4hXu uUB4hu uh-u }GU PE<uEÃC6^$uhu9 E9p}huuhWu jEPuUBU P <EjEPuuhu}9w}huuhWuiuhbuNuhu3uuh|uuhuuh-uUBU PEÃA8Z$uh1u}9w}h:uuh>ucjEPu jEPu9uhCuE9p}hMuuh>uuhRuuh^uuuhuuhwu|uhuauhuFUBU PEÃA8$Ed$$hu}9w}huEd$$hujEPu jEPuEd$$huvE9p}huEd$$hu<Ed$$huEd$$huET$$hu Ed$$huEd$$huEd$$huh#hUBU P4}w(EÃA8$ u PhuE9p}hu u PhWujEPu UQRu u Phu{E9p}hu u PhWu<uh-u! u Phu u Phbu u Ph!u uPu Ph0u u PhXu^ u Ph-u:UBU PEÃA8$ u Ph;uhEuu PhWujEPu jEPu u PhJufhUuu PhWu2 u Ph-u u Ph[u u Phbu u Phcu uPu Phxur u PhuQ u$Pu-hh}G0PhE9p}pFU9rÃYX}Ct"xwyh}uwEl}GHE=~(]EjSum}ۋEĈEE jEPuE@.hue[^_UWVS<} ]EENJUUEat-jt(Jt#xtXtytYtkt KtCuEEƈEɸ}U:t!hh$UzQ uyt P9~ׅy49փ hhjjEpEЃ hhjUBPEhhjUBPE؊ELjEE>EPuE9}}WuSuC9|}Cujhu}t uE}t uE}thhuE؍e[^_UWVS}] EEt Su EC6w7$h hW'hW{pVSQ S0a5$D Q PhW|ECx ~gC$EUCEEUBUU܋UU܅uUP |xEMU9P CU9P hWphW]hWJhW7hW$hWhWF9s}xt}Xt }yt}YuhWhWe[^_UEX| Y~xwhuUE EPEPuuUVSuju Ãt Pu)jaj SVhV$e[^UWVSEE}?t8aw$ E% EG?uȃjujdEElEE}?V ub,$ uƃuE}XhJPu_hhEPUB$U4U܃!hhu܋UBU4 >t>:t C;t;:u ;: VEtuuf:hhuuUuuƃ8:t  F>:u uuƃ:hhuu8 Vhhuu8u2hhuu0EPVhhuu0t2hhuu0EPV9hhuu0EPVhhEPUB$U4U܃! hhu܋UBU4Ut uƃuE}hPu_hhEPUB$U4U܃!hhu܋UBU4 hVu_hhEPUB$U4U܃!hhu܋UBU4 fhJVu_hhEPUB$U4U܃!hhu܋UBU4 HFEPut^hhEPUB$U4U܃!hhu܋UBU4U t uƃtthJPu_hhEPUB$U4U܃!hhu܋UBU4 }u Ew/EPut^hhEPUB$U4U܃!hhu܋UBU4U ] uƃtuhJPu`hhEPUB$U4U܃!hhu܋UBU4 }u E_  uƃuE}4hJPu_hhEPUB$U4U܃!hhu܋UBU4 Vuuu uƃuE}4hJPu\hhEPUB$U4U܃!hhu܋UBU4 q VÃtXhhEPUB$U4U܃!hhu܋UBU4 (^EG? u~Ett/9(M!Mcu 9 Pu E@PuHPhUue[^_UWVSuh3hjjj ÃPVt8t uSPu V6ǃ th8hSe[^_UWVS} uVWPuÃtPW$>e[^_UWVS E 8t!h_h$U z!hbh$}tE At!heh$@ u E$ihjjC؋M APE hjhu ^KSPF Pv E0}t]~~REËU BMARJ Nju>2ЃtfЃtCE 9XU r(huu}thwhue[^_UWVS<]u EEEEt At!hh$l VEPhEPS U}t!}tEx t uu!hh$hhjuÃIME@ t!hh$E@ }HEEUB ;Bs Rt 8u@E؃}~GEHE>mE)@E)EhhjhVSuE܃x(t p(UB(EM܉A(EPE0q };]}O}ԋEEЋUEEB2hhuԋU܋B4hhuԋM܋A4 hhuԋ}܋G 4G8M}Etf}Et}̤C;]P};]E@EEȋEHEăEUUUEEB2hhEPM܋A$4}!U܋B$8MEtfEtC;]|;]}SuC;]|}thhuEES}t uE}thhuE ue[^_ËD$t58u-x(t'@(xu8tzu zuUS]Su!hh$ {t sC]UWVS u] u!hh$L x9^(hh FHPSh F<}w?Uhhjv(ڃ}t  e[^_UWVS }ƃ Ku W WtPhwCh hSu hVu ƃ b2h:Vu ƃ ihVu ƃ fhVu ƃ shEVu ƃ thVu%ƃ kh( hSu thVu%ƃ kh- hSu : Vƃt!ƃ kh2 hSu 0# Wƃu Ѝe[^_ @ @ @ @TABLEtable.ck%1dDefaultFlagflag %s??? NULL?%s?%s??%s?%s:%s%s#Tag%s?flag%s?%s?flag%s%sTRUEFALSE?BOOL?%s?BOOL?#Bool?%s?#Bool%s?int?%d?int?%d??#Int?%d?#Int%d%dInt:%d%d?float?%g?float?%g??#Float?%g?#Float%g%gFloat:%g%g?txt?%s?txt?#Text?%s?#TextText:%s%s?date?%s?date?#Date?%s?#DateDate:%s%s l.Format
%s Key Bool Int Float Text Date Flag
truefalsewrong or missing Int valuewrong or missing Float valuewrong Date valuemissing object nameUnrecognized Tag namemissing bool dataMissing textmissing dateaformatbooltextkeytagtableCreate: received null or empty type stringtableCreate: bad type %c for column %dtableHandleCreate() - just created invalid TABLE something seriously screwy - look at tableExists()tableCopy() - received invalid TABLE* pointertableMax() - received invalid TABLE* pointertableTypes() - received invalid TABLE* pointertableGetColumnName() - received invalid TABLE* pointertableSetColumnName() - received invalid TABLE* pointertableSetColumnName() - col %d is out of bounds 0-%dtableSetColumnName() - name is NULLtableSetString() - received invalid TABLE* pointertableValueNull() - received invalid TABLE* pointertableCheckEmpty() - received invalid TABLE* pointertableClear() - received invalid TABLE* pointertableSetTypes() - received invalid TABLE* pointertableSort() - received invalid TABLE* pointertableSort() - received NULL sort specifiertableMakeUnique() - received invalid TABLE* pointertable.c:tableUnion() - destTable pointer to TABLE* is NULLtable.c:tableUnion() - previously created destTable has incorrect column numbertableDiff() - destTable pointer to TABLE* is NULLtableDiff() - previously created destTable has incorrect column numbertableIntersect() - destTable pointer to TABLE* is NULLtableIntersect() - previously created destTable has incorrect column number%s%s%s%d%g%s%stableRowOut() - invalid column type %ctableSliceOut() received non-magic TABLE* pointertableDoDoParse cannot parse a type: flagsWrong Bool value, should be TRUE or FALSEmissing or unrecognized or protected class name TableResult parse error at line %7d column %d in %.25s : %s tableStore() received non-magic TABLE* pointertableStore() received TABLE with no columnstableStore() called with a non-valid keytableHandleGet called with a non-valid keymissing data in tableHandleGetinconsistent array size in tableHandleGetsizeof(TABLETYPE) = %d != 32 in tableGet: rethink!tableFinalise() received non-magic TABLE* pointersetColumnVisibility() - received NULL TABLE* pointersetColumnVisibility() - col %d is out of bounds 0-%d    l   l        l l UcYwwwwwwwwwwwwi F2o&6&6&6&6&6&6&%%6&6&6&6&6&6&6&6&6&6&6&6&%&6&6&6&6&6&6&6&6&6&6&6&6&6&6&6&6&%%6&6&6&6&6&6&6&6&6&6&6&6&%%X*+050505/k&05{-05k&050505050505050#3(,*&,*,*,*,*,*,*'',*,*,*,*,*,*,*,*,*,*,*,*A)),*,*,*,*,*,*,*h(,*,*,*,*,*,*&,*~'~',*,*,*,*,*,*,*,*,*,*,*,*))*++++++**++++++++++++I++++++++++++++++++**++++++++++++.+j+Z,`-`-`-`-`-`-$,,`-`-`-`-`-`-`-`-`-`-`-`--E-`-`-`-`-`-`-`-`-`-`-`-`-`-`-`-`- ,,`-`-`-`-`-`-`-`-`-`-`-`-,*-..-......-?...............................-$.............u..00/000000d//000000000000@000000000000000000E//000000000000!0_0<221222222H112222222222222222222222222222!22$11222222222222`22O4 53 5 5 5 5 5 5u33 5 5 5 5 5 5 5 5 5 5 5 544 5 5 5 5 5 5 5 5 5 5 5 5 5 5+4 5Q33 5 5 5 5 5 5 5 5 5 5 5 5s44888888888888888888888888888888u8888888u888888888888888888:9$:$:$:99$:9$:9$:$:$:$:$:$:$:9:e;;o;o;o;;;o;;o;;o;o;o;o;o;o;o;;;> D D D:A; D#@ D; D D D D D D DRBCGCC: (GNU) 3.4.3 (csl-sol210-3_4-branch+sol_rpath).symtab.strtab.shstrtab.rel.text.rel.data.bss.rodata.str1.1.rodata.str1.4.rel.rodata.rodata.cst4.comment4N { )O %  /O 42OC2LS V]0 R (` ^8ik!V'n-6BK^PbKC\L pz94;{ L    *;R]s|yg(|2@N`n@y&ny    =    $7F T[lvklZ<n O }!.Q#Y7/8FF(6Tu:1c#q}$ :):e&,G65?ITclvDx'EZ E.BPtable.c_unameunamestatlstatfstatmknodbitFieldTABLE_MAGICtableFinalisetableExistssetColumnVisibilitysortTablesortSpecListtableComparetableDoDoParsetableParseFormattype.0_nuname_xstat_lxstat_fxstat_xmknodtableHandleCreateuMessSetErrorOriginuMessCrashACEIN_LOWERhalloc_dbgblockSetFinalisehandleHandleCreate_dbgstrnew_dbgstackHandleCreate_dbgpushText__ctypestackMarkuArrayCreate_dbgbitSetCreateuTableDestroyuMessFreetableCreateFromKeySetuArray_dbgkeySetCreateFromTabletableMaxkeySetOrderarraySortarrayCompresstableCopyuStackDestroystackCopy_dbguArrayDestroy_dbgarrayCopy_dbgtableTypestableGetColumnNamestackText_dbgtableSetColumnNametableSetColumnHiddentableSetColumnVisibletableColumnIsVisibletableSetStringtabValueNulltableCheckEmptytableClearuArrayReCreate_dbgbitSetReCreatetableSetTypesstrcpykeySetAlphaOrderlexstrcmptableSortsscanfqsorttableMakeUniquestrcmptableIsColumnCompatibletableIsRowEqualtabIsRowEqualtableCopyRowglobalTableCreateHandletabCopyRowtableUniontableDifftableIntersecttableOuttableHeaderOuttableSliceOuttableFooterOuttableOutSetupflagSetDicttableRowOutaceOutPrintaceOutBinarynameiskeyfreejavaprotectclassNamefreeprotectfreeXMLprotectflagNameFromDicttimeShowJavatimeShowtablePartOuttableResultDumptableHandleGetaceInNextaceInWordstrcasecmppickWord2ClasspickListaceInBackaceInPoslexIsGoodNamelexword2keylexaddkeyaceInIntaceInFloattimeParseaceInCardaceInStreamLinemessprintftableCreateFromAceIntableResultParsetableStorememcpyarrayStackStorearrayStackHandleGetstackNextTextACEIN_UPPER 5Me !"# !"5 ?$JP%Yc j& ' $ $ $ $ $ $$1 >(V)*#+ ) , , ),=-o t!{"/   1  21 ,3 1]4c5k6 !"3 8 9) 4:K Y;x : ; : ; !:8 F; !" !"J O!V["q > !" !"   !! & "3  D >T +h )  !  "  & 12 @  O 1\ +l ){  1   1  1 &  + !2 7 "h  ;  @ !G L "k D|  1   1    !  "=  K G^  l G  G H  !  "` j>sJ.PkKV >$ *D>NLd !" !"K ^cGh N 1 1.3P W&d q$O ,  14 A,] f1 , 1- (1C L1j s1 1 : :# +:A I:o/ !"3 8>G g>qQMY h1r 1QkRT  ,>; [>eQV<3 RW3BL `1lz 1 1 1 &12@ O1u 1 1 1 18 R>`Co 1 !"R33&V@  !"IW T3 Wg  l !s x " R 3 3 V  .! 3!!:!?!"U!I!T!W! !!!!""R!"3/"3F"Vj" " "!""""I #T5#Wj#\|#3#]#^#=$ $ %$ W$ i$`|$ $1$ %b$%BH%cd% l%b%%% %b% %b & &b*&c:& B&bg&&&d& &b&c&c'e''cD'cR'dr'c'd'f'g' 'b' '1'd'f(g ( (b$(d,(f5( =(bJ( V(1u( (1(d(h( (b( (1(d(h(g) )b)d$)i-) 5)bH)dP)i\) k)gt) |)b)d)i)d)i) )g))b)d)i* *g* *b3*d;*hD* L*bz*j** *b* *b* *b+c"+c5+ =+bV+ ^+b}++b+ +b+ +b+ + ,, ,b0, 8,bF, N,bg,c,c, ,b, ,b, ,b, -b- -b1-9-bL-T-bg- o-b-- -b- -b- -b.c.c+. 3.bK. S.ba. i.b|. .b. .b..b. .b. .b/ /bA/P/ X/bp/ x/b/ /b/c/c/ /b/ /b 0 0b,0 40bK0 S0bm0u0b00b0 0b0 0b0 1> 1+1f41 <1bT1 \1bj1fs1 {1b1c1c1f1 1b1 1b2f 2 2b(2 02bC2hL2 T2bg2ip2 x2b2i2 2b2i2i22b2i22b3h3 3bM3X3ka3 i3by3 3b3k3 3b3c3c3l3 3b3 4b4l4 4b24l;4 C4bV4l_4 g4bz4l4 4b4l4 4b4l4l44b4l45b5l5h'5b95 >5!Q5V5"5 5b5c5c6 6b66 6!66"637 (7,87 I7$V7 g7$7_7a7 7c7/7/8 8:M83q8y8 8b8 8b8B8<88g9 9b^99 9b9 9b9 9b9 9b9 9b: :b: :bJ: P:b[: a:b: :b:[:o:3 ;[; ;b!;.a;f;; ;p;;q< <r'< ?<1L<Z< n<1<s<t< <1<u<v=p"=q6= A=1V=wk= v=1= =1=x= =1=t= =1>x> #>12>y<> T>1a>r> >1>q> >r> >1> ? ?15? ;?rL? d?1q?? ?1? ?r? ?1?? @1@.@z?@ W@1d@r@ @1@q@ @r@ @1@@ A11A EA{VA nA1{AA A1AqA ArA A1BB $B1IB YBq|B BrB B1BB B1BC Cq-C 3CrDC \C1iCwC C1C|C C1CC C1D D}4D;D BD ID PD WD ^D eD |D~DDD.D D,E E:IH NH!UHZH"HH H!HH"H I87II I1I I1I I1iJ ~J1JJEJ J:K81K 9K:NK.lKK K!KK"K/L $L!+L0L"IL NL!\LaL"L L>L#LLL}Lq M Mr3M $V*n08?GOWUizxapputils.c_unameunamestatlstatfstatmknod_nuname_xstat_lxstat_fxstat_xmknodappCmdlineVersiongetCmdLineOptionaceGetLinkDateStringaceGetReleaseDiraceGetVersionStringprintfexitappTSUsersessionSetUserSessionUsermessQueryuMessFree 5Me     $5Fparse.o/ 1133374782 530 202 100644 22812 ` ELF64( UuUuU u ujU u ujU u ujUuu ujU jjuuuu u US]t;u!h*h$jhS jjjuu jPE ]US]t;u!h>h$jhS jjjuu jP ]UWVS ]} t;u!hPh$jhSƃ]tjWÃjjjjuSV`ƃ t Se[^_U jjjuu ju% U jjjju ju UVSjuËE CtEChEC}tClCpE CduS$ƃt Se[^UVS 5t chhj$hhjh`x@@ @@@ht% hP`P Vhhhh t2 VhhhhP`P+VhhhP`Pt VShxjj<h(j)!e[^UVSuhhu hÃhP`CdChCtClCpCCHCLCDC@C<C8C4C0C,C(C$C CCC ǃs5dshhjV$CC\C|PsCxǃ؍e[^US]Su!hh$4{ tjjS{t sC{Pt sPCP{Xt sXCXt ǃ]ËT$t :`tUWVS ]u}F=v#h7hVhd<Wu su C@Fu CD7 st su܃?uCL5ds? st su܃VhCLe[^_UWVS] Dž`h<Dž8E@u#x Dž8x UB t _ N MǁyXt qX}GXEt UǂMyxt/;A|}$ȃPqu }G| EpÃUuhhjPMhhjS}GXu, wÃ8!u:LJ EpUǂMAǁǁǁƿ8u>}LJ wÃDž`Dž8޿8u:Eǀ pÃuvDž`Dž8|޿8uDUǂǂ rÃuDž`Dž8MyPt qP}GPE@P;>u; h$s{ Urƃ S$ A<v1؅uPh"`Dž8^$u&Sh6`Dž8/$t[}duR LƸM8t&Sh`Dž8$ BuU PMt P}LJShQ`Uj:EpUrƃ Vu1uPhk`Dž8 h_hjV‹MAPǁ$PRu!}wPh`~ ExPt pPUBP Mq}GPu/uPh` huhjEpPUBPt rXwS@MAdיu <UBљu xt @x`u/st{t sC]UShÃtyxtsPz`ujzhBhCxht ,d ,)h\Bh@@h?h ‰CCx`u BP]UWVS( hr9ǃuwtwGxt3@8t+?SSh| Sh0AGph\Bh@@h?h ‰GGx`u0 BPh\Bh@@h?hGV$U$h?hGj@uASG P  V$}fE fEm]muV$U$h?hG j@uSG`P  V$}fE fEm]muV$U$h?hGj@uSP  V$}fE fEm]muV$U$h?hGj@uSP  V$}fE fEm]muV$U$h?hGj@uS P We[^_UShp"t{t sCt S jЋ]UWVS uV^SuF -CPuPshPF PjjvSau F`Yhhjj@ǃ{ t| sHPhPW{|EPsMs|]E$hPWUs\hPW{xt2ڋs|]E$hPWt hWWj@hhjWPF`PƆt Wjjv SuƆƆƆ C(C,C0C8C4C@CDCHCC$C<CLC shPPshPPs hP Pjjv jjv jjve[^_7#"~$$)` 7@P!E!Sl"asv|Open ace FileEnter textQuitClose FileIgnore ErrorsRead allStopRead one ItemRead one LineSkip to next ItemPF /\ @updategeneralarrayobjectParseDispparse.cDtAce_ParserACEDB_DATArdrawdataparseLine-DNo class after -D-RNo class after -R-ANo class after -ADNA(NULL)Bad class name : %sUnrecognised Class %s TagMissing model of class %sObject name %s not validalias (-A)rename (-R)No new name for %sAlias failedRename failed%s, %s-ONo timestamp after -ONo tag after -DUnknown tag "%s"%d%c%s not an integer after %s %lf%c%1.7g%f%s not a float after %s %s not a DateType after %s Tag "%s" does not fit model Extra item on -C lineNo UserSession key after -OTag "%s" not in objectNo Comment after -C// %s readAllreadItemreadLineskipItemparseDispEnterTextType text to be readopenFileraceParsing file %scloseFileStop on ErrorparseDrawFilename: Item: Line:Parsed: OK:Errors:parseDispDestroy%d %.40s%d (%2.0f%%) parseBuffer() - received NULL or empty text-pointerpfFinalise() - received invalid block pointerbad class %d passed to parseArrayregistered function for parse of array data failedNo parser available for array class %dTrying to read/alter a protected class %sObject %s not found in databaseMultiple recursive call to lexalias inside parser%s, cannot get a key for new object "%s" in databaseCan't handle because unknown class typeObject %s is locked - free before continuingtag "%s" : %s - off end of model, addObj failed tag "%s" : %s - off end of model Blank object names names are illicit, sorrytag "%s" : class: "%s" %s - unknown. You can not create an entry in a "Known" class in an indirect way (see options.wrm) %s parse error, near line %d while parsing "%.50s", error was: %sObject %s does not satisfy constraintsdoParseLevel() - received invalid pf pointertotal processed: %d found, %d parsed ok, %d parse failed general: %d errors objects: %d added, %d editted, %d deleted, %d renamed, %d aliased, %d errors arrays: %d added, %d empty, %d deleted, %d errors objects processed: %d found, %d parsed ok, %d parse failed %s() - found non-magic ParseDisp on graphYou no longer have write access!Which ace file do you wish to parse ?\)c=H\)c=ȜWw'&l7Ww'&l?BGCC: (GNU) 3.4.3 (csl-sol210-3_4-branch+sol_rpath).symtab.strtab.shstrtab.rel.text.rel.data.bss.rodata.str1.1.rodata.str1.4.rodata.cst8.rodata.cst4.comment4a+ tI )+| % DX /,42,C2/*R(5(_P5lT545u08 + Bb &>!V'n-8 F7#GO"^b @q~$]{$` P!!~l"m`dxLmT:(q s% \)03w>O(YdE   t|h#c c2rBVe !p, '7GVgt +7BR\enx $3;GPZhv"4JXo#+9AOparse.c_unameunamestatlstatfstatmknodparseGraphparseOptsOpenopenFileparseDispEnterTextparseOptsClosecloseFileignoreErrorsreadAllreadItemreadLineskipItemPF_MAGICPARSE_IN_SPECIALParseDisp_MAGICrealParseAceInpfCreatedoParseLevelparseDispDestroyparseDrawpfFinalisepfExistsparseLineparseArraycurrentParseDispshowStatesaveObjectparseDispExists_nuname_xstat_lxstat_fxstat_xmknodgraphDestroygraphForceInterruptparse_err_typestringsdoParseAceInparseBufferuMessSetErrorOriginuMessCrashaceInCreateFromTextparseBufferInternalparseAceCBufferaceOutCreateToStackuAceOutDestroyparseAceInparseAceInProtecteduMessFreeparseControlcheckWriteAccessgraphActivategraphPophandleHandleCreate_dbgdisplayCreatehalloc_dbggetenvstrcpydbPathStrictFilNamedbPathMakeFilNameuGraphAssociategraphTextBoundsuGraphRegisterblockSetFinaliseaceInSpecialaceInGetURLstrnew_dbgaceInStreamLengthparseFuncaceInCardaceInWordmessprintfaceInStreamPospickWord2ClasspickListnamebsCreatebsDoDestroyaceInSteplexIsGoodNamelexword2keygraphRedrawlexDoAliaslexDestroyAliasarrayKillbsUpdatebsDoKilllexaddkey_VUserSessionuArray_dbgaceInStreamLineaceInNextbsGotobsAddTagbsAddCommentbsSetTimeStampbsType_VQuerybsPushObjbsAddKeysscanfbsAddDatasprintftimeParsebsPrunepickClass2WordhprintfaceOutPrintmessdumpmesserroraceInCardBackuAceInDestroyqueryCheckConstraintsbsDoSavelexCreationUserSessionsessionUserKeylexSetCreationUserSessionkeySetOrderarraySortarrayCompressmessoutuGraphAssFindgraphBusyCursorAllgraphSetBlockModemessIsInterruptCalledgexTextEditorsessionGainWriteAccessaceInCreateFromChoosergraphButtonsgraphBoxCleargraphCleargraphTextgraphBoxStartgraphTextPtrgraphBoxEndwriteAccessChangeRegistergraphBoxDrawstackHandleCreate_dbgpushTextcatTextstackText_dbgstrncpyuStackDestroygraphProcessEvents ++5,M-e./ 56 7+ 057<6I O7 56 7:;>@AB C D  #E+V [Fj oFG    H    HG   IG>!&J2K:ALb oEyM.6N@ HOPPiQ 56>>>@>k 56RST#4<NLS^TnsU C>j>VS P  P& TU T  T    T1  G  { T  >  W T W# X;  A  F Up  u U X X Y   U X Z9 [T  Y Uw \ T ]   U  P ^+ 0 UR >m T    U  P_Z _5fk6`   U>*^> C5N \ bg6^Ua7XTbpcdeD_oT} T feX g_cU> Vh.S PT 1TD h^x }Ui\jk>T]lkT} TfemTn(oMpjYsxU]X^eq' -rMscYm rU r$$$$1 =tL RrjsY UusY Us6^XkqTY Uvj  Y U6;UUwgYpuU U U h2x y%zBzP{`>T   |S[}X~YUA Jgc 56LSxkrx y>A"  ' 52 7 6T i     !;!>X! !>! Y">t" " # ###4+#>?# K#Z#_#{d#0#># # ####N$ $z$ $>$ % % (%,% @%E%b%j%_% %B%% %%%&&8&=&Z& _&d&{&&&$& &&&&&$' ''4'<'B'$s' x'}''''$' ''''(_( *(N(>k(>x(( ( (U(G() )0)h:) ?)UI)e)Vv))) )U)) )U)))) )U)* **1* 9*F*]*o** *U*G* *U*G+ +U+G/+>+M+R+   0 $ (, 04 81< @D HL PT ` d h l p t x dump.o/ 1133374783 530 202 100644 22040 ` ELFD44( UuUuU u ujU u ujU u ujUuu ujUSM ] Au<Hunat Atu0Í,ut0 St;u=tЋ]UuEPu uUjju uUWVS}]EE=t&hjE P5 u Et<u EPWu%}t uEhE AujtJtkt KtCttat AE u܃=t8 u t&E E u $ƃEuVu u $Pu Phu E AtB4ÃC($E UE PuFE;uu uU;u u u EE jEPu QSuE# jEPuXE U PE;uu uU;uu uE;uEu uU;Eu uÃJK~NjE u $Pu Ph"uCE;Et! u Ph+u u Ph/u u u, u $ Ph1u u $ Ph7uU <q RuEE Pu;}u u Et|EÃAtAtHauCE;uhuPuuPuuÃC-$E u $Pu Ph"uLE;Ut! u Ph+u u Ph/u u u, u $ Ph1u u $ Ph7uE u En]EC jSu QVuE C# jSu*E u E Puu}t uE}th=uЍe[^_USDEEEE=EE Eă EPu5 EPjju ut E=u= hh?jjj hh?jjj  Ehh?p PUĉhh?j$à hh?p P 5EPuuEE8 N }~E E Pu] UWVS ] u}A hF$Pht-VSPhhhLP *VPhhh_P Ut'VSPhhhLW $VPhhh_W hohqWu[t-VSPhhhLP *VPhhh_P I .aceD jhuRǃu@PPh0e[^_UVS= p hXp hxhh jhuhwh h hƃ u hp h{Vx tV P4 Q4PP4 PhV UP4P4 PP4PhP<t" 4PC 9Y  =t%h%h?5=t%h&h?5t Ve[^Uh$ tjjUWVS\hjP hjPu hfphWug h4jh h h ÃPWu!h]h?$t SfjhohqPPhƃ hoh?jjÉ$jSǍ$PjWV u SPh SPh Wt Se[^_UWVS0u}Dž\hjPDžDžDžu!hh?$} u!hh?$}uEu!hh?$Du&uhu DžhWt Whtu Dž+j1W )SWPƄ}t%Ph u DžhDžDžWuhjhh?jjPj PhHt!hh?$lht!hh?$l jjjVþ u+hDž t  PuhjhjPhojtRjh hoƃunhDžDž<hDžDž DžtVt" Phu t Vt t t e[^_UWVS8]EEEE5 uM h hjjdjPh$ j$ tSh} uEujjZǃh@@S 5hP h@ShD$u hAE h@h" 5EPh3th=ju VjaV} tTt"hW<$EEu؃VPSǃ{ V Ph?WEPEPEPVuWDEԃ t ENc} tEÃE$Eh@uuuVPhP jjSEPWuE} EE܁} N }~jhW<$EEE$hAhQ Euظ} t VPjǃt,F thW<$E$hAh=t%hh?5e[^_Uhhjh h h t( P h hmhparse_logQuitHelp -O ""%s : %s%s%s%s ?%s?%s? ?%s#?%s? !%s? dump.ctoday%sdump_%s_%c_%s.%d%sdump_%s_%c.%dracewerr%d errors on dumping %s %s %s Do you want to dump comments?dump_*_*.*.ace%s.dump_*_*.1.ace%s/%s File "%s": %s/%s%d.aceeDtDumpSession %dShould I proceed ?Dumping classes DoNotDumpk // Class %s Starting a new dump filerd%s/// a model can not be dumped in .ace format Dump could not open the output file.%d errors occurred during dumpDUMP ERROR: %d errors on dumping Choose file to dump the errors toWriting errors to logfile (database/log.wrm)Do you want to dump timestamps?Sorry, cannot get write access !Unable to retrieve current working directory, using database directory instead.Serious internal error, unable to find database directory.Choose file "dump_*_*.1.ace" of the dumpacein argument to dumpDoReadAll() is NULL.aceout argument to dumpDoReadAll() is NULL.filename argument to dumpDoReadAll() is NULL.Sorry, the name of the file you chose (%s) is not the right format for the first file of an ace dump i.e. it must be of the pattern "dump_*_*.1.ace".Dumpset "%s*.ace" will be read in, do you want to proceedParse Stats for dumpset "%s*.ace" Unable to write to output stack for dump parse messagesAborting dump reading: parsing of dump file %s failed.Aborting dump reading: could not open dump file %sAborting dump reading: could not read dump file %sAny object in the keyset called DoNotDump will be jumped // End of this dump file Class %s : %d keys, %d obj, %d errorsFailed to open dump file, cannot complete dump.Choose directory for dump files9WWWWWW  WWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWW-GCC: (GNU) 3.4.3 (csl-sol210-3_4-branch+sol_rpath).symtab.strtab.shstrtab.rel.text.rel.data.bss.rodata.str1.1.rodata.str1.4.rel.rodata.comment4h EX )  % @S /'!42'qC24)VL.\R `S ^343gt6 " ?a&> V&n,<DMZc mz v$  /    " \     (5:LU ^lzB` %+<F[ht '9DT\fov~)C%;lGNeovX (4<CKXlz$2>KXdump.c_unameunamestatlstatfstatmknoddoNotDumpKeySetdumpDirtrapKeystrapMessagesdumpMenudumpGraphdumpKey2oldJmpBuf.0dumpClassdumpDestroyletter.1date.2dumpOpenOutputdirectory.3filename.4dump1CheckdumpSetDirectorydirectory.5filename.6_nuname_xstat_lxstat_fxstat_xmknodgraphDestroyhelpdumpClassPossiblepickListdumpFunclexMaxVisible_VUserSessiondumpTimeStampsdumpKeyBeautifullydumpKeykeySetOrderarrayFindlexIsKeyVisiblequeryFind3bsDoDestroylexCreationUserSessionnamefreeprotectclassNameaceOutPrintiskey_VDNAdnaDumpKeyCstyle_VPeptidepeptideDumpKeyCstyleaceOutBinaryjavaDumpDNAjavaDumpPeptide_VKeySetjavaDumpKeySet_VLongTextjavaDumpLongTextfreejavaprotectbsCreate_VModelbsAceDumpniceDumpbsUpdatesetjmpmessCatchCrashuArrayCreate_dbguArray_dbgmessCaughtMessagestrnew_dbgaceOutStreamPoslexNexttimeParsetimeShowstrcpysprintffilCheckNameaceOutCreateToFilegraphTextgraphRedrawmessoutmessdumpaceOutCreateToChooseruMessFreeuArrayDestroy_dbguAceOutDestroydumpAllmessQuerydumpCommentsdumpAllNonInteractivedumpReadAllmemsetsessionGainWriteAccessmesserrorgetcwddbPathMakeFilNameuMessSetErrorOriginuMessCrashaceInCreateFromChooserstackHandleCreate_dbgstackTextOnlyaceOutCreateToStackdumpDoReadAllpopTextuStackDestroyisWriteAccessregExpMatchstrrchrmemcpyhprintfdoParseAceInaceInCreateFromFileuAceInDestroygraphActivatedisplayCreategraphBoxMenugraphTextBoundsuGraphRegistergraphColorgraphPopgraphClearthisSessionmessprintflexword2keyuArrayGetlexMaxpickClass2WordgraphBoxStartgraphBoxEndgraphBoxDrawfilqueryopenfilclose ""5#M$e%&*+***,"-/.123454*kpy.667789: *5P;a<q=>?7@@@;$<4AE>UBfC}DEF7G9:,95=:M9V^:l;7G:7G:+;+)H\Ifn:JK7G9:#9,4:D9MU:c;v7~G:7G:7@@$@;LPKd5|:MN - 8 O= J U OZ l q z P  Q R   P  N S T& M V [ Uc Vl q W     X     X      X   # ) X4 9 ? YX ^ c h t X     X  Z  [ \  % * ]2 : ? ^G L Q W[ ` e j o t _  ]   :   7  9  : 0 @ 7L \ 9e j ^r  `      a    a b05d:.AFdKecfhhijkj l&W:?mFKn[`kopqrst jt(-]9bIuuhmnmnm%*n2v;iGO:qww:xyd18zHQp`qpr:mn:m n#{?J:y`zYY|:8C:t:}`bu<A~PUZbiu}W[[ \',d8'V[[`\iCrw):b *39:x[S:b:?[\:b[a\."',AINSXX'(   $(,048<@DHLPTX\`dhlptx|  $(,048<@DHLPTXbiblio.o/ 1133374784 530 202 100644 33080 ` ELF|L4( UuUuU u ujU u ujU u ujUuu ujUEPhu$jdh hh}u$jdh hh$E8t$jdh hhHExtjfh pE@Ext pE@Ex8tjhh p8E@8Ex<tjih p<E@<Ex@tjjh p@E@@ExDtjkh pDE@DExHtjlh pHE@HExLtjmh pLE@LExPtjnh pPE@PEx t p E@ E}t uEUS EPhu$j{h h$h}u$j{h h$h$E8t$j{h h$hHj$Uz0B0Eƒx0t5@x ~_hh Sr<CUB9X 8E‹@x ~%hh Sr<CUB9X ۃ uuQ]USÃEPhu'hh h4h}u'hh h4h$E8t'hh h4hHj$t?Ext @x u hp u\$]UWVS}EPhu'hh hBh}u'hh hBh$E8t'hh hBhHhh jEpƃ9#>t> t F>t> ux_uCF9~@>t> t F>t> uF>_t>u Pe[^_UWVS4EPhu'hh hSh}u'hh hSh$E8t'hh hShHj$,EPEPEPEPME+AEܙ=ƃ}A9p E9tHChh SEpHHE؃thh PEp889uEE EX,Eܙ= VDEU9Pu;x7}t1jjhh up0Uz~/jjBBP jjUBBPEU܉PjjUBBP}hh u؋Ep@8jjUBBPmEH=hh u؋Ep8hh Ep pPU؉E@ EHU E9B~B+BE@( uuE܃=hh u؋Ep@8hh u؋Ep_uFE}uUBW$$Gh@V}t ECWjPe[^_UEPhu'hh hhh}u'hh hhh$E8t'hh hhhH uUWVSLEEp,?S ff@VSh_$VhAjDUr h#h jEpÉEE;t; t C;t; uUE8_w@EEE}uUBẼE$hAhuE$EPEPEPu E]EPE]EPm]EPm]EPẺƋE+p=ƿEE9tDEh;h uȋUrHHEh<h PEp8 89uhAh uċUr@8}t=hBh uċEp<8uE$h Bh}E$h Bh EPEPEPEPu E]EPE]EPm]EPm]EPE$h BhUz4t0 jEd$$h\BRDEBPh E$Eh@u}tUC]0=uuj Exx(‹@@ 9B}BBU9~E@jjUBBPEHș=ƿEE9tDEhlh uȋUrHHEhmh PEp8 89u}th jVPjuh?h jVPu}u&hBh p@8tChCh p<ƅ8u }u  P5d E VjDžDžCVhV8t Dž ut CPh[h jVPDž+|Xh]h jVPjPu +;} 9=t%hdh 5t Ve[^_UWVS,EEhoh u u0ƺǰуMEt< u]CI9r]CI9s'<-uE <.uECI9r޻وI+M}E|9vوуMhju]CI9s9<.tM}9AM}u9.AMCI9rɉу9MtUM BU;]}UG}C;]~M}|9 uO}EUe[^_UWVS<} ]hh jhƃPhu'hh hhu'hh hh$8t'hh hhHt"utu G uhuu jjphPu$h jj5DžDž 9ƅhh pHHhh pL hh p884Whh pD%ٽf f٭۝٭j@PhPu Phua VhV55j VDžƒx AujR5hPVB ;u,z ~hV5h*V"@ H;thVuShh j50hh pL 9B x ~hVPj5t h0PV P5t) PhPVP5t PVPj5tdhPV h PVPjj!uPj5t_h6PV h PVPjj!uÍPj5tuh;PV h PVPjj!uÃhVPj5tph PV hPVPjj!uÃhVCPhh jVPjuhh jVPu}u&hh p@8tChh p<ƅ8u }u  P5d E VjDžDžCVhV8t Dž ut CPh/h jVPDž+|Xh1h jVPjPu +;} 95=t%h8h 5t Ve[^_UWVS }t} tE xu xtxt!hHh $M y u h@hPh jjTE FhSh jh FFF F(F$F@ F hYh jjFF $Zh jjFp F8h[h jjFp F<h\h jjFp F@h]h jjFp FDh^h jjFp FHh_h jjFp FLh`h jjFp FP Fx hbh WvD_S$$ch WvHM Q4ÃtREP5St, uuhfh Wv@ SGF9x OjFuv F @E$\uh@jhjh_j hj Vh4$`4$e[^_UMU B$t'|Ct*:rr0rQ&rr0rQrr0rQUShh jEuePÃu PSLt S]UVSu hh jjj à hh jP0SVPhlPe[^UVS]tt% Bt ;t;u 5Ptg} t\ SÃtE P JtA;tJuthh SЍe[^Uju UWVS ]t{u{t {u{ u <љEuE9}9hh VS@;t;u u9|Ǹgfff)‰UuE9}+hh VSj01uu9|ոi_Vgfff)‰UuE9}+hh VSj0uu9|ոe[^_UWVS]hhSƃPSǃ hhPÃp PEthh Vthh Wthh SEe[^_UWVSL}hh jh EEt7EPhuE}tE8tE}E} t"E xuxtxu H M̅uhWmẼ}tE@jjPhPW$,h jj5 EE E9EEMԉMă}tah4h QEpHHEh5h uԋEpL h6h uċEp88FEȋUċE PEԉEЃ}t7h@h PEpD% }fE޴ fEm]mރuEjE@PhPW$ PhW$ƃ u EP5V uPuEPhMh juPuEjuWhNh juPEuƒ5V5 jV{ uE ƒx }t?hWh uR0PhPu~hYh u5 0Pu}tDh\h u5 0h\h uԋEpL EЋ M9J (huEPhah juPuEjuWhbh juPEuEEP5Vt'EuEjuPWEPj5Vtg}uEuEjhWuhW]uh WSjj!VuEPj5Vtp}uEuEjhWhW uhW]uh WSjj!VuڍEPj5Vtd}uEuEjhWuhW]uh WSjj!Vu{EPj5Vtb}uEuEjhWuhW]uhWSjj!VuڍEPj5Vt0}uuEjhWuhW}t[}u hh uċEp@8t5hh uċEp<E8u VS}u }7EP5V uà ujSEE8uuhuEE8t EE SEut SEPhh juPE+E|@hh juPEuEjPW CE+E9} VEԋE9E:= t%hh 5  }t ue[^_( W q'3BIBLIO_MAGICbiblio.cbiblioDestroyBiblioAbstractsBiblioPrint80biblioPostBufferBiblioPickbiblioSortbiblioSortAuthorbiblioUnDiscardbiblioNewNumbersbiblioRenumberNormalCellGen.& Dev.biblioFormatQuitHelpPrintAbstract on/offSort by authorRenumber 1 ... nSort by numberUnDiscardNew numbersFormatformatNormalformatCellformatGenDevTopic : BiblioReDrawDiscardAbstract on Abstract off GENES & DEVELOPMENTbiblioDumpCellFound %d refzzzzzz_%d) %s, and , (%d). %s %d %s, %s-%d.-%s biblioDumpGenDev and %d. %s: %d:Sorry, no associated biblioDtBiblioBiblioBibliography attached to %sNEIGHBOURSCLASS Paper, %s : %d (%d)%s() could not find BIBLIO on graph%s() received NULL BIBLIO pointer%s received non-magic BIBLIO pointerNothing to export, this biblio is empty, , sorrySorry, no related bibliographybiblioDisplay - received NULL title or invalid KEYSET bibSet??????GCC: (GNU) 3.4.3 (csl-sol210-3_4-branch+sol_rpath).symtab.strtab.shstrtab.rel.text.rel.data.bss.rodata.str1.1.rodata.str1.4.rodata.cst4.rodata.cst8.comment4G ]" )`G % ` /G42GC2JRK_KlK4LuN 1 |W &>"V(n.;AL@Z_jRxq( {E4+_W \ q}; "/:GT@X_9c pf{( 8 `*, 6:  $/AOYew />ISbp|.7BKS]gou,9HX=/ c*:Tp{:=~:g;;[biblio.c_unameunamestatlstatfstatmknodBIBLIO_MAGICnbBoxdiscardingbiblioDestroybiblioAbstractsbiblioPreparebiblioDoReDrawbiblioPrint80biblioDraw80biblioReDrawbiblioPostBufferbiblioPickbiblioSortbiblioSortAuthorbiblioUnDiscardbiblioNewNumbersbiblioRenumberformatMenuformatNormalformatCellformatGenDevbiblioFormatbiblioMenubiblioFormatDumpcellAuthoraut.0biblioDumpCellgenDevAuthoraut.1biblioDumpGenDevbiblioDisplaybiblioKeyPossible2aut.2_nuname_xstat_lxstat_fxstat_xmknoduGraphAssFinduMessSetErrorOriginuMessCrashuArrayDestroy_dbguStackDestroyuMessFreegraphActivegraphCheckEditorsuArray_dbgmessoutgraphActivatestackText_dbggraphPostBuffergraphWheredisplaygraphBoxDrawstrcmpgraphBoxMenugraphButtonsgraphDestroyhelpstackReCreate_dbgaceOutCreateToStackuAceOutDestroygraphCleargraphTextgraphTextEntrygraphBoxStartgraphBoxEndgraphTextBoundsgraphRedrawgraphPrintgraphGotographBoxDimgraphRectanglegraphFloatEditornamememsetstackHandleCreate_dbgaceOutPrintmessprintfaceOutxyuArrayReCreate_dbgbsCreatestackClearpushText_AuthorbsFindTagbsFlattencatText_YearbsGetData_TitlebsGetKey_Journal_Volume_PageuLinesTextuNextLinebsDoDestroy_AbstractstackGetstackCursorstackNextTexthalloc_dbguArrayCreate_dbgiskeystrncpydisplayCreategraphRetitleuGraphRegisteruGraphAssociatebiblioDumpbiblioKeySetstrnew_dbgbiblioFollowbiblioKeypickList_VPaper_VLongTextbsIsClassInClassbsKeySetbiblioKeyPossiblebiblioPossiblequeryParametrizedkeySetORkeySetAlphaHeap 1152M3e456 7 8 7 8 7 80 89Y:y 9 9 9 9 !9A I9i q9;;6 7 8 7" ',88D I7Q V[8k<s= > >0<>C6W \7d in8 7 8 7 8<= ?#@JO6c h7p uz8 7 8 7 8 ANBmr6 7 8 7 8 7 8 <=4CG > > #>-DQEjEE >E >  $ >5 V    >  >  >% E> Ee j 6~  7   8  7   8   7   8 < =;  D >i  r >  >  >  >  >   >'  3 >?  M >^  l >  6  7   8  7    8* 9  > 7F  K P 8` <h =  >  > F > (>9 G>S a>p ~> > > > > > '>~6 7 8 7 8 7  8<%=G T>` l> >6 7 $)8? D7L QV8bq v7~ 8<=6 7  8) .76 ;@8L[ `7h mr8 > > >!65 :7B GL8b g7o ty8 7 8GH 6  %7- 278M R7Z _d8p 7 8G6 7  8" '7/ 498ET Y7a fk8G6 7 8 7 8) .76 ;@8krG KLMN OP  A*QZR_QORSTU6 7 8 7 #(84C H7P UZ8NV OP AQ$R)Q@QV [OuW~&&&&XRQ >" .>E S>o }> O OW&&&& X8 =OERt yYQRQRORST GEV > > >EH8EWEvE O O O O" /K=LXM >Z1[@  L \] b 6v  { 7   8  7   8   7   8,!4!]N! S!^_!_k! u!z!`!! !>! !>! " ">L" `">h"" "^"_"Z" "]"a#b # #c#d%#e9#F#fZ#bl## #^#g## #g## #g$ $$$>.$Z>$ R$>i$$h$i$ $^$g$j$k$Z$ $^%g%l%k4%Z>%gP%m[%ip% u%^%g% %^%g%i%m%i% %^&g& &^&&g?&iU&n`&iu& z&^&g& &^&g&i& &g&n&i ' '^'g-' 2'^<'gU'id' j'g' 'A'o'_' 'A'p' (>( +(>H(qs(r~(k(s(b(t(g( (g+)uO):f) n)Aw)o) )A)p)_)q*,* 2*7*9@*Q*:}* *>*Z_+[5, A,\R,W,6k, p,7x, },,8, ,7, ,,8,, ,7, ,,8!-)-]C- H-^T-_`- j-o-`t-- ->- ->- - .>A. U.>].. .^._.Z. .].a.b/ /c/d/e./;/fO/ba/// /^/g// /g 0 0g0.0 40gM0 U0Z0>d0Zt0 0>000 0g0h0i0 0^1g1j&1k;1ZD1 I1^S1gf1lq1k1Z1g1m1i1 1^1g1 1^1g 2i'2m22iG2 L2^V2gi2 n2^x2g2i2n2i2 2^2g2 2^2g3i 3 &3g=3nH3i]3 b3^l3g3 3^3g3i3 3g3 3A3o4_4 4A&4pC4 W4>i4 }4>4q4r4k4s5b5t;5gC5 I5g}5u5:5 5A5o5 5A6p"6_M6qn6~6 66966:6 67668 7 7?$7 -7v57E7 Q7\7 7v7 7w7 7w7 7w7 8w8 )8w98 H8wX8 g8w8 8>8 8>8a8r8k8x9 9> 9q@9yN9 S9z^9{f9m9Gu9|9|99|99|99}9~7: E: K:X:r:;: :w: :>:Z: :^: ;";*;?;J;j;;; ;9>< E<>R<Z<< <>= =>G= L= R=^=h= m= s=== =9= =9= =9= >\><$>)>6F>>>]> >^>_> >>`>? %?>5? C?>I? V? d?>? ?>?? ?^?_?Z? ?]@a@b*@j0@kF@ZR@ci@ s@A|@o@_@ @A@p@d@e@@fAbA.A 7A>AAZJA OA^[AgmA vA{A>AZAgA AA>AZA A>AA BgB $BA-BoCB_SB ]BAfBpBlBkBZB_BmBiB B_B C]C C],CiDCmJCikC qC_|C C]C C]C C]CiCnCiC C_D D]!D 'D]5DiJDnPDiqD wD_D D]D D]DiDhDiD D_D D]E &E>8E FE>[EqErEkEsEbEtEgE EgFu*F:DF NFAWFowF FAFpF_FqFF FF9FG: $ (, 04 @ID HJL PT X\ `d hl pt x|   aceversion.o/ 1133374784 530 202 100644 2656 ` ELFP4( UuUuU u ujU u ujU u ujUuu ujøø øøøáát*@(#) @(#) ------------------------------------------------------------------------ @(#) ACEDB 4.9.27, compiled on: Nov 30 2005 12:19:44 @(#) Copyright (c): J Thierry-Mieg and R Durbin, 1998 @(#) @(#) This file contains the above Sanger Informatics Group library, @(#) written by Richard Durbin (Sanger Centre, UK) rd@sanger.ac.uk @(#) Jean Thierry-Mieg (CRBM du CNRS, France) mieg@kaa.crbm.cnrs-mop.fr @(#) Ed Griffiths (Sanger Centre, UK) edgrif@sanger.ac.uk @(#) Fred Wobus (Sanger Centre, UK) fw@sanger.ac.uk @(#) You may redistribute this software subject to the conditions in the @(#) accompanying copyright file. Anyone interested in obtaining an up to date @(#) version should contact one of the authors at the above email addresses. @(#) ------------------------------------------------------------------------ @(#) compiled on: Nov 30 2005 12:19:44RELEASE.EXPERIMENTALNov 30 2005 12:19:44ACEDB 4.9.27GCC: (GNU) 3.4.3 (csl-sol210-3_4-branch+sol_rpath).symtab.strtab.shstrtab.rel.text.rel.data.bss.rodata.str1.4.rodata.str1.1.comment4 P ) % H  /42C27R4[0   & >&V,n2DU]dlt|aceversion.c_unameunamestatlstatfstatmknodlinkdate_string.0version_string.1_nuname_xstat_lxstat_fxstat_xmknodcopyrightaceGetVersionaceGetReleaseaceGetUpdateaceGetReleaseDiraceGetLinkDateaceGetLinkDateStringaceGetVersionString 5Me